PDB entry 1y25

View 1y25 on RCSB PDB site
Description: structure of mycobacterial thiol peroxidase Tpx
Class: oxidoreductase
Keywords: oxidoreductase
Deposited on 2004-11-20, released 2005-11-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.175
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Probable thiol peroxidase
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: Rv1932 tpx
    Database cross-references and differences (RAF-indexed):
    • Uniprot P66952 (2-164)
      • expression tag (0-1)
      • engineered (59)
    Domains in SCOPe 2.07: d1y25a1, d1y25a2
  • Chain 'B':
    Compound: Probable thiol peroxidase
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: Rv1932 tpx
    Database cross-references and differences (RAF-indexed):
    • Uniprot P66952 (2-164)
      • expression tag (0-1)
      • engineered (59)
    Domains in SCOPe 2.07: d1y25b2, d1y25b3
  • Heterogens: ACT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1y25A (A:)
    hsqitlrgnaintvgelpavgspapaftltggdlgvissdqfrgksvllnifpsvdtpvs
    atsvrtfderaaasgatvlcvskdlpfaqkrfcgaegtenvmpasafrdsfgedygvtia
    dgpmagllaraivvigadgnvaytelvpeiaqepnyeaalaalga
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1y25B (B:)
    hsqitlrgnaintvgelpavgspapaftltggdlgvissdqfrgksvllnifpsvdtpvs
    atsvrtfderaaasgatvlcvskdlpfaqkrfcgaegtenvmpasafrdsfgedygvtia
    dgpmagllaraivvigadgnvaytelvpeiaqepnyeaalaalga