PDB entry 1y21

View 1y21 on RCSB PDB site
Description: Crystal Structure of Cimex Nitrophorin NO Complex
Class: ligand binding protein
Keywords: heme protein; beta-sandwich; NO carrier; ferrous NO complex; S-nitrosocysteine, LIGAND BINDING PROTEIN
Deposited on 2004-11-19, released 2004-11-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-02-29, with a file datestamp of 2012-02-24.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: 0.17
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Salivary nitrophorin
    Species: Cimex lectularius [TaxId:79782]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1y21a_
  • Heterogens: NO, HEM, TRS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1y21A (A:)
    gsppaqlsvhtvswnsgheraptnleellglnsgetpdviavavqgfgfqtdkpqqgpac
    vknfqslltskgytklkntitetmgltvyclekhldqntlknetiivtvddqkksggivt
    sftiynkrfsfttsrmsdedvtstntkyaydtrldyskkddpsdflfwigdlnvrvetna
    thakslvdqnnidglmafdqlkkakeqklfdgwtepqvtfkptykfkpntdeydlsatps
    wtdralyksgtgktiqplsynsltnykqtehrpvlakfrvtl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1y21A (A:)
    ppaqlsvhtvswnsgheraptnleellglnsgetpdviavavqgfgfqtdkpqqgpacvk
    nfqslltskgytklkntitetmgltvyclekhldqntlknetiivtvddqkksggivtsf
    tiynkrfsfttsrmsdedvtstntkyaydtrldyskkddpsdflfwigdlnvrvetnath
    akslvdqnnidglmafdqlkkakeqklfdgwtepqvtfkptykfkpntdeydlsatpswt
    dralyksgtgktiqplsynsltnykqtehrpvlakfrvtl