PDB entry 1y20

View 1y20 on RCSB PDB site
Description: Crystal structure of the NR1 ligand-binding core in complex with ACPC
Class: ligand binding protein
Keywords: Protein-ligand complex; ligand-binding complex, LIGAND BINDING PROTEIN
Deposited on 2004-11-19, released 2005-07-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-07-26, with a file datestamp of 2017-07-21.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: N/A
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glutamate [NMDA] receptor subunit zeta 1
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P35439 (Start-151)
      • insertion (152-153)
    • Uniprot P35439 (154-End)
    Domains in SCOPe 2.07: d1y20a_
  • Heterogens: 1AC, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1y20A (A:)
    gmstrlkivtihqepfvyvkptmsdgtckeeftvngdpvkkvictgpndtspgsprhtvp
    qccygfcidlliklartmnftyevhlvadgkfgtqervnnsnkkewngmmgellsgqadm
    ivapltinneraqyiefskpfkyqgltilvkkgtritgindprlrnpsdkfiyatvkqss
    vdiyfrrqvelstmyrhmekhnyesaaeaiqavrdnklhafiwdsavlefeasqkcdlvt
    tgelffrsgfgigmrkdspwkqnvslsilkshengfmedldktwvryqecds
    

    Sequence, based on observed residues (ATOM records): (download)
    >1y20A (A:)
    rlkivtihqepfvyvkptmsdgtckeeftvngdpvkkvictgpndtspgsprhtvpqccy
    gfcidlliklartmnftyevhlvadgkfgtqervnnsnkkewngmmgellsgqadmivap
    ltinneraqyiefskpfkyqgltilvkkgtritgindprlrnpsdkfiyatvkqssvdiy
    frrqvelstmyrhmekhnyesaaeaiqavrdnklhafiwdsavlefeasqkcdlvttgel
    ffrsgfgigmrkdspwkqnvslsilkshengfmedldktwvryqecd