PDB entry 1y1x

View 1y1x on RCSB PDB site
Description: Structural analysis of a homolog of programmed cell death 6 protein from Leishmania major Friedlin
Deposited on 2004-11-19, released 2004-12-07
The last revision prior to the SCOP 1.71 freeze date was dated 2004-12-07, with a file datestamp of 2004-12-07.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.19
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1y1xa_
  • Chain 'B':
    Domains in SCOP 1.71: d1y1xb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1y1xA (A:)
    mahhhhhhmptstgvyapsarhmndnqelmewfravdtdgsgaisvpelnaalssagvpf
    slattekllhmydknhsgeitfdefkdlhhfilsmregfrkrdssgdgrldsnevraall
    ssgyqvseqtfqalmrkfdrqrrgslgfddyvelsifvcrvrnvfafydrertgqvtftf
    dtfiggsvsil
    

    Sequence, based on observed residues (ATOM records): (download)
    >1y1xA (A:)
    ptstgvyapsarhmndnqelmewfravdtdgsgaisvpelnaalssagvpfslattekll
    hmydknhsgeitfdefkdlhhfilsmregfrkrdssgdgrldsnevraallssgyqvseq
    tfqalmrkfdrqrrgslgfddyvelsifvcrvrnvfafydrertgqvtftfdtfiggsvs
    il
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1y1xB (B:)
    mahhhhhhmptstgvyapsarhmndnqelmewfravdtdgsgaisvpelnaalssagvpf
    slattekllhmydknhsgeitfdefkdlhhfilsmregfrkrdssgdgrldsnevraall
    ssgyqvseqtfqalmrkfdrqrrgslgfddyvelsifvcrvrnvfafydrertgqvtftf
    dtfiggsvsil
    

    Sequence, based on observed residues (ATOM records): (download)
    >1y1xB (B:)
    tstgvyapsqelmewfravdtdgsgaisvpelnaalssagvpfslattekllhmydknhs
    geitfdefkdlhhfilsmregfrkrdssgdgrldsnevraallssgyqvseqtfqalmrk
    fdrqrrgslgfddyvelsifvcrvrnvfafydrertgqvtftfdtfiggsvsil