PDB entry 1y1u

View 1y1u on RCSB PDB site
Description: structure of unphosphorylated stat5a
Deposited on 2004-11-19, released 2005-10-04
The last revision was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 3.21 Å
R-factor: N/A
AEROSPACI score: 0.09 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Signal transducer and activator of transcription 5A
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Signal transducer and activator of transcription 5A
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: Signal transducer and activator of transcription 5A
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >1y1uA (A:)
    spagvlvdamsqkhlqinqrfeelrlitqdtenelkklqqtqeyfiiqyqeslriqaqfa
    qlgqlnpqermsretalqqkqvsletwlqreaqtlqqyrvelaekhqktlqllrkqqtii
    lddeliqwkrrqqlagnggppegsldvlqswceklaeiiwqnrqqirraehlcqqlpipg
    pveemlaevnatitdiisalvtstfiiekqppqvlktqtkfaatvrllvggklnvhmnpp
    qvkatiiseqqaksllknentrnecsgeilnnccvmeyhqatgtlsahfrnmslkrikra
    drrgaesvteekftvlfesqfsvgsnelvfqvktlslpvvvivhgsqdhnatatvlwdna
    faepgrvpfavpdkvlwpqlcealnmkfkaevqsnrgltkenlvflaqklfnissnhled
    ynsmsvswsqfnrenlpgwnytfwqwfdgvmevlkkhhkphwndgailgfvnkqqahdll
    inkpdgtfllrfsdseiggitiawkfdspdrnlwnlkpfttrdfsirsladrlgdlnyli
    yvfpdrpkdevfakyytpvlakavdgyvkpqikqvvpefvnastd
    

    Sequence, based on observed residues (ATOM records):
    >1y1uA (A:)
    sqkhlqinqrfeelrlitqdtenelkklqqtqeyfiiqyqeslriqaqfaqlgqlnpqer
    msretalqqkqvsletwlqreaqtlqqyrvelaekhqktlqllrkqqtiilddeliqwkr
    rqqlagnggppegsldvlqswceklaeiiwqnrqqirraehlcqqlpipgpveemlaevn
    atitdiisalvtstfiiekqppqvlktqtkfaatvrllvggklnvhmnppqvkatiiseq
    qaksllknentrnecsgeilnnccvmeyhqatgtlsahfrnmslkresvteekftvlfes
    qfsvgsnelvfqvktlslpvvvivhgsqdhnatatvlwdnafaepgrvpfavpdkvlwpq
    lcealnmkfkaevqsnrgltkenlvflaqklfnissnhledynsmsvswsqfnrenlpgw
    nytfwqwfdgvmevlkkhhkphwndgailgfvnkqqahdllinkpdgtfllrfsdseigg
    itiawkfdspdrnlwnlkpfttrdfsirsladrlgdlnyliyvfpdrpkdevfakyytpv
    laka
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >1y1uB (B:)
    spagvlvdamsqkhlqinqrfeelrlitqdtenelkklqqtqeyfiiqyqeslriqaqfa
    qlgqlnpqermsretalqqkqvsletwlqreaqtlqqyrvelaekhqktlqllrkqqtii
    lddeliqwkrrqqlagnggppegsldvlqswceklaeiiwqnrqqirraehlcqqlpipg
    pveemlaevnatitdiisalvtstfiiekqppqvlktqtkfaatvrllvggklnvhmnpp
    qvkatiiseqqaksllknentrnecsgeilnnccvmeyhqatgtlsahfrnmslkrikra
    drrgaesvteekftvlfesqfsvgsnelvfqvktlslpvvvivhgsqdhnatatvlwdna
    faepgrvpfavpdkvlwpqlcealnmkfkaevqsnrgltkenlvflaqklfnissnhled
    ynsmsvswsqfnrenlpgwnytfwqwfdgvmevlkkhhkphwndgailgfvnkqqahdll
    inkpdgtfllrfsdseiggitiawkfdspdrnlwnlkpfttrdfsirsladrlgdlnyli
    yvfpdrpkdevfakyytpvlakavdgyvkpqikqvvpefvnastd
    

    Sequence, based on observed residues (ATOM records):
    >1y1uB (B:)
    sqkhlqinqrfeelrlitqdtenelkklqqtqeyfiiqyqeslriqaqfaqlgqlnpqer
    msretalqqkqvsletwlqreaqtlqqyrvelaekhqktlqllrkqqtiilddeliqwkr
    rqqlagnggppegsldvlqswceklaeiiwqnrqqirraehlcqqlpipgpveemlaevn
    atitdiisalvtstfiiekqppqvlktqtkfaatvrllvggklnvhmnppqvkatiiseq
    qaksllknentrnecsgeilnnccvmeyhqatgtlsahfrnmslkresvteekftvlfes
    qfsvgsnelvfqvktlslpvvvivhgsqdhnatatvlwdnafaepgrvpfavpdkvlwpq
    lcealnmkfkaevqsnrgltkenlvflaqklfnissnhledynsmsvswsqfnrenlpgw
    nytfwqwfdgvmevlkkhhkphwndgailgfvnkqqahdllinkpdgtfllrfsdseigg
    itiawkfdspdrnlwnlkpfttrdfsirsladrlgdlnyliyvfpdrpkdevfakyytpv
    laka
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >1y1uC (C:)
    spagvlvdamsqkhlqinqrfeelrlitqdtenelkklqqtqeyfiiqyqeslriqaqfa
    qlgqlnpqermsretalqqkqvsletwlqreaqtlqqyrvelaekhqktlqllrkqqtii
    lddeliqwkrrqqlagnggppegsldvlqswceklaeiiwqnrqqirraehlcqqlpipg
    pveemlaevnatitdiisalvtstfiiekqppqvlktqtkfaatvrllvggklnvhmnpp
    qvkatiiseqqaksllknentrnecsgeilnnccvmeyhqatgtlsahfrnmslkrikra
    drrgaesvteekftvlfesqfsvgsnelvfqvktlslpvvvivhgsqdhnatatvlwdna
    faepgrvpfavpdkvlwpqlcealnmkfkaevqsnrgltkenlvflaqklfnissnhled
    ynsmsvswsqfnrenlpgwnytfwqwfdgvmevlkkhhkphwndgailgfvnkqqahdll
    inkpdgtfllrfsdseiggitiawkfdspdrnlwnlkpfttrdfsirsladrlgdlnyli
    yvfpdrpkdevfakyytpvlakavdgyvkpqikqvvpefvnastd
    

    Sequence, based on observed residues (ATOM records):
    >1y1uC (C:)
    sqkhlqinqrfeelrlitqdtenelkklqqtqeyfiiqyqeslriqaqfaqlgqlnpqer
    msretalqqkqvsletwlqreaqtlqqyrvelaekhqktlqllrkqqtiilddeliqwkr
    rqqlagnggppegsldvlqswceklaeiiwqnrqqirraehlcqqlpipgpveemlaevn
    atitdiisalvtstfiiekqppqvlktqtkfaatvrllvggklnvhmnppqvkatiiseq
    qaksllknentrnecsgeilnnccvmeyhqatgtlsahfrnmslkresvteekftvlfes
    qfsvgsnelvfqvktlslpvvvivhgsqdhnatatvlwdnafaepgrvpfavpdkvlwpq
    lcealnmkfkaevqsnrgltkenlvflaqklfnissnhledynsmsvswsqfnrenlpgw
    nytfwqwfdgvmevlkkhhkphwndgailgfvnkqqahdllinkpdgtfllrfsdseigg
    itiawkfdspdrnlwnlkpfttrdfsirsladrlgdlnyliyvfpdrpkdevfakyytpv
    laka