PDB entry 1y1t

View 1y1t on RCSB PDB site
Description: Crystal Structure of the Uridine Phosphorylase from Salmonella Typhimurium at 1.77A Resolution
Class: transcription
Keywords: nucleoside phosphorylase, TRANSCRIPTION
Deposited on 2004-11-19, released 2005-11-22
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 1.7700000000000002 Å
R-factor: N/A
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Uridine phosphorylase
    Species: SALMONELLA TYPHIMURIUM [TaxId:99287]
    Gene: UDP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1y1ta_
  • Chain 'F':
    Compound: Uridine phosphorylase
    Species: SALMONELLA TYPHIMURIUM [TaxId:99287]
    Gene: UDP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1y1tf_
  • Heterogens: GOL, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1y1tA (A:)
    msksdvfhlgltkndlqgaqlaivpgdpervekiaalmdkpvklashreftswraeldgk
    avivcstgiggpstsiaveelaqlgirtflrigttgaiqphinvgdvlvttasvrldgas
    lhfapmefpavadfacttalveaaksigatthvgvtassdtfypgqerydtysgrvvrrf
    kgsmeewqamgvmnyemesatlltmcasqglragmvagvivnrtqqeipnaetmkqtesh
    avkivveaarrll
    

    Sequence, based on observed residues (ATOM records): (download)
    >1y1tA (A:)
    sdvfhlgltkndlqgaqlaivpgdpervekiaalmdkpvklashreftswraeldgkavi
    vcstgiggpstsiaveelaqlgirtflrigttgaiqphinvgdvlvttasvrldgaslhf
    apmefpavadfacttalveaaksigatthvgvtassdtfypgqerydtysgrvvrrfkgs
    meewqamgvmnyemesatlltmcasqglragmvagvivnrtqqeipnaetmkqteshavk
    ivveaarrll
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1y1tF (F:)
    msksdvfhlgltkndlqgaqlaivpgdpervekiaalmdkpvklashreftswraeldgk
    avivcstgiggpstsiaveelaqlgirtflrigttgaiqphinvgdvlvttasvrldgas
    lhfapmefpavadfacttalveaaksigatthvgvtassdtfypgqerydtysgrvvrrf
    kgsmeewqamgvmnyemesatlltmcasqglragmvagvivnrtqqeipnaetmkqtesh
    avkivveaarrll
    

    Sequence, based on observed residues (ATOM records): (download)
    >1y1tF (F:)
    sdvfhlgltkndlqgaqlaivpgdpervekiaalmdkpvklashreftswraeldgkavi
    vcstgiggpstsiaveelaqlgirtflrigttgaiqphinvgdvlvttasvrldgaslhf
    apmefpavadfacttalveaaksigatthvgvtassdtfsmeewqamgvmnyemesatll
    tmcasqglragmvagvivnkqteshavkivveaarrll