PDB entry 1y1r

View 1y1r on RCSB PDB site
Description: Crystal Structure of the Uridine Phosphorylase from Salmonella Typhimurium in Complex with Inhibitor and Phosphate Ion at 2.11A Resolution
Class: transferase
Keywords: nucleoside phosphorylase, transferase
Deposited on 2004-11-19, released 2005-11-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 2.11 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Uridine phosphorylase
    Species: SALMONELLA TYPHIMURIUM [TaxId:99287]
    Gene: UDP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1y1ra_
  • Chain 'B':
    Compound: Uridine phosphorylase
    Species: SALMONELLA TYPHIMURIUM [TaxId:99287]
    Gene: UDP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1y1rb_
  • Chain 'C':
    Compound: Uridine phosphorylase
    Species: SALMONELLA TYPHIMURIUM [TaxId:99287]
    Gene: UDP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1y1rc_
  • Chain 'D':
    Compound: Uridine phosphorylase
    Species: SALMONELLA TYPHIMURIUM [TaxId:99287]
    Gene: UDP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1y1rd_
  • Chain 'E':
    Compound: Uridine phosphorylase
    Species: SALMONELLA TYPHIMURIUM [TaxId:99287]
    Gene: UDP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1y1re_
  • Chain 'F':
    Compound: Uridine phosphorylase
    Species: SALMONELLA TYPHIMURIUM [TaxId:99287]
    Gene: UDP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1y1rf_
  • Heterogens: PO4, BJE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1y1rA (A:)
    msksdvfhlgltkndlqgaqlaivpgdpervekiaalmdkpvklashreftswraeldgk
    avivcstgiggpstsiaveelaqlgirtflrigttgaiqphinvgdvlvttasvrldgas
    lhfapmefpavadfacttalveaaksigatthvgvtassdtfypgqerydtysgrvvrrf
    kgsmeewqamgvmnyemesatlltmcasqglragmvagvivnrtqqeipnaetmkqtesh
    avkivveaarrll
    

    Sequence, based on observed residues (ATOM records): (download)
    >1y1rA (A:)
    ksdvfhlgltkndlqgaqlaivpgdpervekiaalmdkpvklashreftswraeldgkav
    ivcstgiggpstsiaveelaqlgirtflrigttgaiqphinvgdvlvttasvrldgaslh
    fapmefpavadfacttalveaaksigatthvgvtassdtfypgqerydtysgrvvrrfkg
    smeewqamgvmnyemesatlltmcasqglragmvagvivnrtqqeipnaetmkqteshav
    kivveaarrll
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1y1rB (B:)
    msksdvfhlgltkndlqgaqlaivpgdpervekiaalmdkpvklashreftswraeldgk
    avivcstgiggpstsiaveelaqlgirtflrigttgaiqphinvgdvlvttasvrldgas
    lhfapmefpavadfacttalveaaksigatthvgvtassdtfypgqerydtysgrvvrrf
    kgsmeewqamgvmnyemesatlltmcasqglragmvagvivnrtqqeipnaetmkqtesh
    avkivveaarrll
    

    Sequence, based on observed residues (ATOM records): (download)
    >1y1rB (B:)
    sdvfhlgltkndlqgaqlaivpgdpervekiaalmdkpvklashreftswraeldgkavi
    vcstgiggpstsiaveelaqlgirtflrigttgaiqphinvgdvlvttasvrldgaslhf
    apmefpavadfacttalveaaksigatthvgvtassdtfypgqerydtysgrvvrrfkgs
    meewqamgvmnyemesatlltmcasqglragmvagvivnrtqqeipnshavkivveaarr
    ll
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1y1rC (C:)
    msksdvfhlgltkndlqgaqlaivpgdpervekiaalmdkpvklashreftswraeldgk
    avivcstgiggpstsiaveelaqlgirtflrigttgaiqphinvgdvlvttasvrldgas
    lhfapmefpavadfacttalveaaksigatthvgvtassdtfypgqerydtysgrvvrrf
    kgsmeewqamgvmnyemesatlltmcasqglragmvagvivnrtqqeipnaetmkqtesh
    avkivveaarrll
    

    Sequence, based on observed residues (ATOM records): (download)
    >1y1rC (C:)
    ksdvfhlgltkndlqgaqlaivpgdpervekiaalmdkpvklashreftswraeldgkav
    ivcstgiggpstsiaveelaqlgirtflrigttgaiqphinvgdvlvttasvrldgaslh
    fapmefpavadfacttalveaaksigatthvgvtassdtfypgqerydtysgrvvrrfkg
    smeewqamgvmnyemesatlltmcasqglragmvagvivnrtqmkqteshavkivveaar
    rll
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1y1rD (D:)
    msksdvfhlgltkndlqgaqlaivpgdpervekiaalmdkpvklashreftswraeldgk
    avivcstgiggpstsiaveelaqlgirtflrigttgaiqphinvgdvlvttasvrldgas
    lhfapmefpavadfacttalveaaksigatthvgvtassdtfypgqerydtysgrvvrrf
    kgsmeewqamgvmnyemesatlltmcasqglragmvagvivnrtqqeipnaetmkqtesh
    avkivveaarrll
    

    Sequence, based on observed residues (ATOM records): (download)
    >1y1rD (D:)
    sdvfhlgltkndlqgaqlaivpgdpervekiaalmdkpvklashreftswraeldgkavi
    vcstgiggpstsiaveelaqlgirtflrigttgaiqphinvgdvlvttasvrldgaslhf
    apmefpavadfacttalveaaksigatthvgvtassdtfypgqerydtysgrvvrrfkgs
    meewqamgvmnyemesatlltmcasqglragmvagvivnrtmkqteshavkivveaarrl
    l
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1y1rE (E:)
    msksdvfhlgltkndlqgaqlaivpgdpervekiaalmdkpvklashreftswraeldgk
    avivcstgiggpstsiaveelaqlgirtflrigttgaiqphinvgdvlvttasvrldgas
    lhfapmefpavadfacttalveaaksigatthvgvtassdtfypgqerydtysgrvvrrf
    kgsmeewqamgvmnyemesatlltmcasqglragmvagvivnrtqqeipnaetmkqtesh
    avkivveaarrll
    

    Sequence, based on observed residues (ATOM records): (download)
    >1y1rE (E:)
    ksdvfhlgltkndlqgaqlaivpgdpervekiaalmdkpvklashreftswraeldgkav
    ivcstgiggpstsiaveelaqlgirtflrigttgaiqphinvgdvlvttasvrldgaslh
    fapmefpavadfacttalveaaksigatthvgvtassdtfypgqerydtysgrvvrrfkg
    smeewqamgvmnyemesatlltmcasqglragmvagvivnrtqqteshavkivveaarrl
    l
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1y1rF (F:)
    msksdvfhlgltkndlqgaqlaivpgdpervekiaalmdkpvklashreftswraeldgk
    avivcstgiggpstsiaveelaqlgirtflrigttgaiqphinvgdvlvttasvrldgas
    lhfapmefpavadfacttalveaaksigatthvgvtassdtfypgqerydtysgrvvrrf
    kgsmeewqamgvmnyemesatlltmcasqglragmvagvivnrtqqeipnaetmkqtesh
    avkivveaarrll
    

    Sequence, based on observed residues (ATOM records): (download)
    >1y1rF (F:)
    ksdvfhlgltkndlqgaqlaivpgdpervekiaalmdkpvklashreftswraeldgkav
    ivcstgiggpstsiaveelaqlgirtflrigttgaiqphinvgdvlvttasvrldgaslh
    fapmefpavadfacttalveaaksigatthvgvtassdtfypgqerydtysgrvvrrfkg
    smeewqamgvmnyemesatlltmcasqglragmvagvivnrtqqeshavkivveaarrll