PDB entry 1y1q

View 1y1q on RCSB PDB site
Description: Crystal Structure of the Uridine Phosphorylase from Salmonella Typhimurium in Complex with Uridine-5p-monophosphate and Sulfate Ion at 2.35A Resolution
Class: transferase
Keywords: nucleoside phosphorylase, transferase
Deposited on 2004-11-19, released 2005-11-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2.35 Å
R-factor: N/A
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Uridine phosphorylase
    Species: SALMONELLA TYPHIMURIUM [TaxId:99287]
    Gene: UDP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1y1qa_
  • Chain 'B':
    Compound: Uridine phosphorylase
    Species: SALMONELLA TYPHIMURIUM [TaxId:99287]
    Gene: UDP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1y1qb_
  • Chain 'C':
    Compound: Uridine phosphorylase
    Species: SALMONELLA TYPHIMURIUM [TaxId:99287]
    Gene: UDP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1y1qc_
  • Chain 'D':
    Compound: Uridine phosphorylase
    Species: SALMONELLA TYPHIMURIUM [TaxId:99287]
    Gene: UDP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1y1qd_
  • Chain 'E':
    Compound: Uridine phosphorylase
    Species: SALMONELLA TYPHIMURIUM [TaxId:99287]
    Gene: UDP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1y1qe_
  • Chain 'F':
    Compound: Uridine phosphorylase
    Species: SALMONELLA TYPHIMURIUM [TaxId:99287]
    Gene: UDP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1y1qf_
  • Heterogens: SO4, U, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1y1qA (A:)
    msksdvfhlgltkndlqgaqlaivpgdpervekiaalmdkpvklashreftswraeldgk
    avivcstgiggpstsiaveelaqlgirtflrigttgaiqphinvgdvlvttasvrldgas
    lhfapmefpavadfacttalveaaksigatthvgvtassdtfypgqerydtysgrvvrrf
    kgsmeewqamgvmnyemesatlltmcasqglragmvagvivnrtqqeipnaetmkqtesh
    avkivveaarrll
    

    Sequence, based on observed residues (ATOM records): (download)
    >1y1qA (A:)
    sdvfhlgltkndlqgaqlaivpgdpervekiaalmdkpvklashreftswraeldgkavi
    vcstgiggpstsiaveelaqlgirtflrigttgaiqphinvgdvlvttasvrldgaslhf
    apmefpavadfacttalveaaksigatthvgvtassdtfypgqerydtysgrvvrrfkgs
    meewqamgvmnyemesatlltmcasqglragmvagvivnrtqqeipnaetmkqteshavk
    ivveaarrll
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1y1qB (B:)
    msksdvfhlgltkndlqgaqlaivpgdpervekiaalmdkpvklashreftswraeldgk
    avivcstgiggpstsiaveelaqlgirtflrigttgaiqphinvgdvlvttasvrldgas
    lhfapmefpavadfacttalveaaksigatthvgvtassdtfypgqerydtysgrvvrrf
    kgsmeewqamgvmnyemesatlltmcasqglragmvagvivnrtqqeipnaetmkqtesh
    avkivveaarrll
    

    Sequence, based on observed residues (ATOM records): (download)
    >1y1qB (B:)
    sdvfhlgltkndlqgaqlaivpgdpervekiaalmdkpvklashreftswraeldgkavi
    vcstgiggpstsiaveelaqlgirtflrigttgaiqphinvgdvlvttasvrldgaslhf
    apmefpavadfacttalveaaksigatthvgvtassdtfypgqerydtysgrvvrrfkgs
    meewqamgvmnyemesatlltmcasqglragmvagvivnrtqteshavkivveaarrll
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1y1qC (C:)
    msksdvfhlgltkndlqgaqlaivpgdpervekiaalmdkpvklashreftswraeldgk
    avivcstgiggpstsiaveelaqlgirtflrigttgaiqphinvgdvlvttasvrldgas
    lhfapmefpavadfacttalveaaksigatthvgvtassdtfypgqerydtysgrvvrrf
    kgsmeewqamgvmnyemesatlltmcasqglragmvagvivnrtqqeipnaetmkqtesh
    avkivveaarrll
    

    Sequence, based on observed residues (ATOM records): (download)
    >1y1qC (C:)
    sdvfhlgltkndlqgaqlaivpgdpervekiaalmdkpvklashreftswraeldgkavi
    vcstgiggpstsiaveelaqlgirtflrigttgaiqphinvgdvlvttasvrldgaslhf
    apmefpavadfacttalveaaksigatthvgvtassdtfypgqerydtysgrvvrrfkgs
    meewqamgvmnyemesatlltmcasqglragmvagvivnrtqqteshavkivveaarrll
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1y1qD (D:)
    msksdvfhlgltkndlqgaqlaivpgdpervekiaalmdkpvklashreftswraeldgk
    avivcstgiggpstsiaveelaqlgirtflrigttgaiqphinvgdvlvttasvrldgas
    lhfapmefpavadfacttalveaaksigatthvgvtassdtfypgqerydtysgrvvrrf
    kgsmeewqamgvmnyemesatlltmcasqglragmvagvivnrtqqeipnaetmkqtesh
    avkivveaarrll
    

    Sequence, based on observed residues (ATOM records): (download)
    >1y1qD (D:)
    sdvfhlgltkndlqgaqlaivpgdpervekiaalmdkpvklashreftswraeldgkavi
    vcstgiggpstsiaveelaqlgirtflrigttgaiqphinvgdvlvttasvrldgaslhf
    apmefpavadfacttalveaaksigatthvgvtassdtfypgqerydtysgrvvrrfkgs
    meewqamgvmnyemesatlltmcasqglragmvagvivnrtqaetmkqteshavkivvea
    arrll
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1y1qE (E:)
    msksdvfhlgltkndlqgaqlaivpgdpervekiaalmdkpvklashreftswraeldgk
    avivcstgiggpstsiaveelaqlgirtflrigttgaiqphinvgdvlvttasvrldgas
    lhfapmefpavadfacttalveaaksigatthvgvtassdtfypgqerydtysgrvvrrf
    kgsmeewqamgvmnyemesatlltmcasqglragmvagvivnrtqqeipnaetmkqtesh
    avkivveaarrll
    

    Sequence, based on observed residues (ATOM records): (download)
    >1y1qE (E:)
    sdvfhlgltkndlqgaqlaivpgdpervekiaalmdkpvklashreftswraeldgkavi
    vcstgiggpstsiaveelaqlgirtflrigttgaiqphinvgdvlvttasvrldgaslhf
    apmefpavadfacttalveaaksigatthvgvtassdtfypgqerydtysgrvvrrfkgs
    meewqamgvmnyemesatlltmcasqglragmvagvivnrtqeshavkivveaarrll
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1y1qF (F:)
    msksdvfhlgltkndlqgaqlaivpgdpervekiaalmdkpvklashreftswraeldgk
    avivcstgiggpstsiaveelaqlgirtflrigttgaiqphinvgdvlvttasvrldgas
    lhfapmefpavadfacttalveaaksigatthvgvtassdtfypgqerydtysgrvvrrf
    kgsmeewqamgvmnyemesatlltmcasqglragmvagvivnrtqqeipnaetmkqtesh
    avkivveaarrll
    

    Sequence, based on observed residues (ATOM records): (download)
    >1y1qF (F:)
    sdvfhlgltkndlqgaqlaivpgdpervekiaalmdkpvklashreftswraeldgkavi
    vcstgiggpstsiaveelaqlgirtflrigttgaiqphinvgdvlvttasvrldgaslhf
    apmefpavadfacttalveaaksigatthvgvtassdtfypgqerydtysgrvvrrfkgs
    meewqamgvmnyemesatlltmcasqglragmvagvivnrtqqeipnteshavkivveaa
    rrll