PDB entry 1y1p

View 1y1p on RCSB PDB site
Description: X-ray structure of aldehyde reductase with NADPH
Class: oxidoreductase
Keywords: Rossmann fold, short chain dehydrogenase reductase
Deposited on 2004-11-19, released 2005-09-06
The last revision prior to the SCOP 1.73 freeze date was dated 2005-09-13, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.217
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Aldehyde reductase II
    Species: Sporobolomyces salmonicolor
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1y1pa1
  • Chain 'B':
    Compound: Aldehyde reductase II
    Species: Sporobolomyces salmonicolor
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1y1pb1
  • Heterogens: SO4, ACT, NMN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1y1pA (A:)
    akidnavlpegslvlvtgangfvashvveqllehgykvrgtarsasklanlqkrwdakyp
    grfetavvedmlkqgaydevikgaagvahiasvvsfsnkydevvtpaiggtlnalraaaa
    tpsvkrfvltsstvsalipkpnvegiyldekswnlesidkaktlpesdpqkslwvyaask
    teaelaawkfmdenkphftlnavlpnytigtifdpetqsgstsgwmmslfngevspalal
    mppqyyvsavdigllhlgclvlpqierrrvygtagtfdwntvlatfrklypsktfpadfp
    dqgqdlskfdtapsleilkslgrpgwrsieesikdlvgseta
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1y1pB (B:)
    akidnavlpegslvlvtgangfvashvveqllehgykvrgtarsasklanlqkrwdakyp
    grfetavvedmlkqgaydevikgaagvahiasvvsfsnkydevvtpaiggtlnalraaaa
    tpsvkrfvltsstvsalipkpnvegiyldekswnlesidkaktlpesdpqkslwvyaask
    teaelaawkfmdenkphftlnavlpnytigtifdpetqsgstsgwmmslfngevspalal
    mppqyyvsavdigllhlgclvlpqierrrvygtagtfdwntvlatfrklypsktfpadfp
    dqgqdlskfdtapsleilkslgrpgwrsieesikdlvgseta