PDB entry 1y1n

View 1y1n on RCSB PDB site
Description: Identification of SH3 motif in M. Tuberculosis methionine aminopeptidase suggests a mode of interaction with the ribosome
Deposited on 2004-11-18, released 2005-05-24
The last revision was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.51 Å
R-factor: 0.202
AEROSPACI score: 0.61 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Methionine aminopeptidase 1B
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: map, mapB
    Database cross-references and differences (RAF-indexed):
  • Heterogens: K, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >1y1nA (A:)
    hhhhhhmpsrtalspgvlsptrpvpnwiarpeyvgkpaaqegsepwvqtpeviekmrvag
    riaagalaeagkavapgvttdeldriaheylvdngaypstlgykgfpkscctslnevich
    gipdstvitdgdivnidvtayiggvhgdtnatfpagdvadehrllvdrtreatmraintv
    kpgralsvigrviesyanrfgynvvrdftghgigttfhnglvvlhydqpavetimqpgmt
    ftiepminlgaldyeiwddgwtvvtkdrkwtaqfehtllvtdtgveiltcl
    

    Sequence, based on observed residues (ATOM records):
    >1y1nA (A:)
    rtalspgvlsptrpvpnwiarpeyvgkpaaqegsepwvqtpeviekmrvagriaagalae
    agkavapgvttdeldriaheylvdngaypstlgykgfpkscctslnevichgipdstvit
    dgdivnidvtayiggvhgdtnatfpagdvadehrllvdrtreatmraintvkpgralsvi
    grviesyanrfgynvvrdftghgigttfhnglvvlhydqpavetimqpgmtftiepminl
    galdyeiwddgwtvvtkdrkwtaqfehtllvtdtgveiltcl