PDB entry 1y1l

View 1y1l on RCSB PDB site
Description: Crystal structure of arsenate reductase from Archaeoglobus fulgidus DSM 4304, structural genomics
Class: transferase
Keywords: ARSENATE REDUCTASE, DETOXIFICATION, CADMIUM, OXIDIZED FORM, Structural Genomics, PSI, Protein Structure Initiative, New York SGX Research Center for Structural Genomics, NYSGXRC, TRANSFERASE
Deposited on 2004-11-18, released 2004-11-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: N/A
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: arsenate reductase (arsC)
    Species: ARCHAEOGLOBUS FULGIDUS [TaxId:224325]
    Gene: AF1361
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1y1la_
  • Chain 'B':
    Compound: arsenate reductase (arsC)
    Species: ARCHAEOGLOBUS FULGIDUS [TaxId:224325]
    Gene: AF1361
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1y1lb_
  • Chain 'C':
    Compound: arsenate reductase (arsC)
    Species: ARCHAEOGLOBUS FULGIDUS [TaxId:224325]
    Gene: AF1361
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1y1lc_
  • Chain 'D':
    Compound: arsenate reductase (arsC)
    Species: ARCHAEOGLOBUS FULGIDUS [TaxId:224325]
    Gene: AF1361
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1y1ld_
  • Heterogens: CD

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1y1lA (A:)
    kvlfvcihntarsvmaealfnamakswkaesagvekaervdetvkrllaerglkakekpr
    tvdevnlddfdlivtvceesscvvlptdkpvtrwhienpagkdegtyrrvlaeieervkk
    lvge
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1y1lB (B:)
    kvlfvcihntarsvmaealfnamakswkaesagvekaervdetvkrllaerglkakekpr
    tvdevnlddfdlivtvceesscvvlptdkpvtrwhienpagkdegtyrrvlaeieervkk
    lvge
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1y1lC (C:)
    kvlfvcihntarsvmaealfnamakswkaesagvekaervdetvkrllaerglkakekpr
    tvdevnlddfdlivtvceesscvvlptdkpvtrwhienpagkdegtyrrvlaeieervkk
    lvge
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1y1lD (D:)
    kvlfvcihntarsvmaealfnamakswkaesagvekaervdetvkrllaerglkakekpr
    tvdevnlddfdlivtvceesscvvlptdkpvtrwhienpagkdegtyrrvlaeieervkk
    lvge