PDB entry 1y1g

View 1y1g on RCSB PDB site
Description: Human formylglycine generating enzyme, double sulfonic acid form
Class: oxidoreductase
Keywords: Formylglycine, multiple sulfatase deficiency, cysteine sulfenic acid, OXIDOREDUCTASE
Deposited on 2004-11-18, released 2005-05-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-10-05, with a file datestamp of 2011-09-30.
Experiment type: XRAY
Resolution: 1.67 Å
R-factor: 0.147
AEROSPACI score: 0.6 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'X':
    Compound: C-alpha-formyglycine-generating enzyme
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • GB AAO34683 (Start-301)
    Domains in SCOPe 2.07: d1y1gx_
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'X':
    Sequence, based on SEQRES records: (download)
    >1y1gX (X:)
    eanapgpvpgerqlahskmvpipagvftmgtddpqikqdgeaparrvtidafymdayevs
    ntefekfvnstgylteaekfgdsfvfegmlseqvktniqqavaaapwwlpvkganwrhpe
    gpdstilhrpdhpvlhvswndavayctwagkrlpteaeweyscrgglhnrlfpwgnklqp
    kgqhyaniwqgefpvtntgedgfqgtapvdafppngyglynivgnawewtsdwwtvhhsv
    eetlnpkgppsgkdrvkkggsymchrsycyryrcaarsqntpdssasnlgfrcaadrlpt
    mdrgshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1y1gX (X:)
    lahskmvpipagvftmgtddpqikqdgeaparrvtidafymdayevsntefekfvnstgy
    lteaekfgdsfvfegmlapwwlpvkganwrhpegpdstilhrpdhpvlhvswndavayct
    wagkrlpteaeweyscrgglhnrlfpwgnklqpkgqhyaniwqgefpvtntgedgfqgta
    pvdafppngyglynivgnawewtsdwwtvhhsveetlnpkgppsgkdrvkkggsymchrs
    ycyryrcaarsqntpdssasnlgfrcaadrlptmd