PDB entry 1y1b

View 1y1b on RCSB PDB site
Description: Solution structure of Anemonia elastase inhibitor
Deposited on 2004-11-18, released 2005-07-19
The last revision was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Elastase inhibitor
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >1y1bA (A:)
    kpdcplictmqydpvcgsdgitygnacmllgascrsdtpielvhkgrc