PDB entry 1y18

View 1y18 on RCSB PDB site
Description: Fab fragment of catalytic elimination antibody 34E4 E(H50)D mutant in complex with hapten
Class: immune system
Keywords: Immunoglobulin, Catalytic antibody, chimeric Fab, Hapten complex
Deposited on 2004-11-17, released 2005-04-05
The last revision prior to the SCOP 1.75 freeze date was dated 2005-04-05, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.215
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Catalytic antibody 34E4 light chain
    Species: Mus Musculus, Homo sapiens
    Domains in SCOP 1.75: d1y18a1, d1y18a2
  • Chain 'B':
    Compound: Catalytic antibody 34E4 heavy chain
    Species: Mus Musculus, Homo sapiens
    Domains in SCOP 1.75: d1y18b1, d1y18b2
  • Chain 'C':
    Compound: Catalytic antibody 34E4 light chain
    Species: Mus Musculus, Homo sapiens
    Domains in SCOP 1.75: d1y18c1, d1y18c2
  • Chain 'D':
    Compound: Catalytic antibody 34E4 heavy chain
    Species: Mus Musculus, Homo sapiens
    Domains in SCOP 1.75: d1y18d1, d1y18d2
  • Chain 'E':
    Compound: Catalytic antibody 34E4 light chain
    Species: Mus Musculus, Homo sapiens
    Domains in SCOP 1.75: d1y18e1, d1y18e2
  • Chain 'F':
    Compound: Catalytic antibody 34E4 heavy chain
    Species: Mus Musculus, Homo sapiens
    Domains in SCOP 1.75: d1y18f1, d1y18f2
  • Chain 'H':
    Compound: Catalytic antibody 34E4 heavy chain
    Species: Mus Musculus, Homo sapiens
    Domains in SCOP 1.75: d1y18h1, d1y18h2
  • Chain 'L':
    Compound: Catalytic antibody 34E4 light chain
    Species: Mus Musculus, Homo sapiens
    Domains in SCOP 1.75: d1y18l1, d1y18l2
  • Heterogens: CL, HAN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1y18A (A:)
    elvvtqesalttspgetvtltcrsssgavttsnyatwvqekpdhlftgliggtnkrapgv
    parfsgsligdraaltitgaqtedeaiyfcalwnsnhlvfgggtkleikrtvaapsvfif
    ppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsst
    ltlskadyekhkvyacevthqglsspvtksfnrgec
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1y18B (B:)
    evkllesggglaqpggslklscaasgfdfrrywmtwvrqapgkglewigdinpdsrtiny
    mpslkdkfiisrdnaknslylqlsrlrsedsalyycvrldfdvynhyyvldywgqgtsvt
    vssastkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavl
    qssglyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepksc
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1y18C (C:)
    elvvtqesalttspgetvtltcrsssgavttsnyatwvqekpdhlftgliggtnkrapgv
    parfsgsligdraaltitgaqtedeaiyfcalwnsnhlvfgggtkleikrtvaapsvfif
    ppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsst
    ltlskadyekhkvyacevthqglsspvtksfnrgec
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1y18D (D:)
    evkllesggglaqpggslklscaasgfdfrrywmtwvrqapgkglewigdinpdsrtiny
    mpslkdkfiisrdnaknslylqlsrlrsedsalyycvrldfdvynhyyvldywgqgtsvt
    vssastkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavl
    qssglyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepksc
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1y18E (E:)
    elvvtqesalttspgetvtltcrsssgavttsnyatwvqekpdhlftgliggtnkrapgv
    parfsgsligdraaltitgaqtedeaiyfcalwnsnhlvfgggtkleikrtvaapsvfif
    ppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsst
    ltlskadyekhkvyacevthqglsspvtksfnrgec
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1y18F (F:)
    evkllesggglaqpggslklscaasgfdfrrywmtwvrqapgkglewigdinpdsrtiny
    mpslkdkfiisrdnaknslylqlsrlrsedsalyycvrldfdvynhyyvldywgqgtsvt
    vssastkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavl
    qssglyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepksc
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1y18H (H:)
    evkllesggglaqpggslklscaasgfdfrrywmtwvrqapgkglewigdinpdsrtiny
    mpslkdkfiisrdnaknslylqlsrlrsedsalyycvrldfdvynhyyvldywgqgtsvt
    vssastkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavl
    qssglyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepksc
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1y18L (L:)
    elvvtqesalttspgetvtltcrsssgavttsnyatwvqekpdhlftgliggtnkrapgv
    parfsgsligdraaltitgaqtedeaiyfcalwnsnhlvfgggtkleikrtvaapsvfif
    ppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsst
    ltlskadyekhkvyacevthqglsspvtksfnrgec