PDB entry 1y17

View 1y17 on RCSB PDB site
Description: crystal structure of Aa-X-bp-II, a snake venom protein with the activity of binding to coagulation factor X from Agkistrodon acutus
Class: blood clotting
Keywords: Aa-X-bp-II, C-type lectin-like proteins, snake venom, Agkistrodon acutus, BLOOD CLOTTING
Deposited on 2004-11-17, released 2006-03-07
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.18
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: anticoagulant protein A
    Species: Deinagkistrodon acutus [TaxId:36307]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1y17a1
  • Chain 'B':
    Compound: anticoagulant protein-B
    Species: Deinagkistrodon acutus [TaxId:36307]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1y17b_
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1y17A (A:)
    dcssswssyeghcykafkqsktwadaesfctkqvngghlvsiessgeadfvahliaqkik
    sakihvwiglraqnkekqcsiewsdgssisyenwieeeskkclgvhkatgfrkwenfyce
    qrdpfvcea
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1y17B (B:)
    dcpsdwssyeghcykpfnepknwadaenfctqqhtgshlvsfqsteeadfvvklafqtfd
    ygifwmglskiwnqcnwqwsnaamlkytdwaeesycvyfkstnnkwrsitcrmianfvce
    fqa