PDB entry 1y15

View 1y15 on RCSB PDB site
Description: Mouse Prion Protein with mutation N174T
Class: unknown function
Keywords: PrP, NMR, prion protein, TSE, CWD, UNKNOWN FUNCTION
Deposited on 2004-11-17, released 2004-12-28
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: major prion protein
  Species: Mus musculus [TaxId:10090]
  Gene: PRNP
  Database cross-references and differences (RAF-indexed):
  • Uniprot P04925 (0-111)
    • engineered (53)
  Domains in SCOPe 2.01: d1y15a_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1y15A (A:)
  vvgglggymlgsamsrpmihfgndwedryyrenmyrypnqvyyrpvdqysnqntfvhdcv
  nitikqhtvttttkgenftetdvkmmervveqmcvtqyqkesqayydgrrss