PDB entry 1y14

View 1y14 on RCSB PDB site
Description: Crystal structure of yeast subcomplex of Rpb4 and Rpb7
Deposited on 2004-11-17, released 2004-12-14
The last revision prior to the SCOP 1.71 freeze date was dated 2004-12-21, with a file datestamp of 2004-12-21.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.228
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1y14A (A:)
    lkqinhqgeeeelialnlsearlvikealverrrafkrsqkkhkkkhlkhenandettav
    ededddldeddvnaddddfmhsetrekelesidvlleqttggnnkdlkntmqyltnfsrf
    rdqetvgaviqllkstglhpfevaqlgslacdtadeaktlipslnnkisddelerilkel
    snletly
    

    Sequence, based on observed residues (ATOM records): (download)
    >1y14A (A:)
    elialnlsearlvikealverrrafkrsqtrekelesidvlleqttggnnkdlkntmqyl
    tnfsrfrdqetvgaviqllkstglhpfevaqlgslacdtadeaktlipslnnkisddele
    rilkelsnletly
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1y14B (B:)
    mffikdlslnitlhpsffgprmkqylktklleevegsctgkfgyilcvldydnidiqrgr
    ilptdgsaefnvkyravvfkpfkgevvdgtvvscsqhgfevqvgpmkvfvtkhlmpqdlt
    fnagsnppsyqssedvitiksrirvkiegcisqvssihaigsikedylgai
    

    Sequence, based on observed residues (ATOM records): (download)
    >1y14B (B:)
    mffikdlslnitlhpsffgprmkqylktklleevegsctgkfgyilcvldydnidiqfnv
    kyravvfkpfkgevvdgtvvscsqhgfevqvgpmkvfvtkhlmpqdltfnasyqssedvi
    tiksrirvkiegcisqvssihaigsikedylgai
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1y14C (C:)
    lkqinhqgeeeelialnlsearlvikealverrrafkrsqkkhkkkhlkhenandettav
    ededddldeddvnaddddfmhsetrekelesidvlleqttggnnkdlkntmqyltnfsrf
    rdqetvgaviqllkstglhpfevaqlgslacdtadeaktlipslnnkisddelerilkel
    snletly
    

    Sequence, based on observed residues (ATOM records): (download)
    >1y14C (C:)
    elialnlsearlvikealverrrafkrsqkkhtrekelesidvlleqttggnnkdlkntm
    qyltnfsrfrdqetvgaviqllkstglhpfevaqlgslacdtadeaktlipslnnkisdd
    elerilkelsnletly
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1y14D (D:)
    mffikdlslnitlhpsffgprmkqylktklleevegsctgkfgyilcvldydnidiqrgr
    ilptdgsaefnvkyravvfkpfkgevvdgtvvscsqhgfevqvgpmkvfvtkhlmpqdlt
    fnagsnppsyqssedvitiksrirvkiegcisqvssihaigsikedylgai
    

    Sequence, based on observed residues (ATOM records): (download)
    >1y14D (D:)
    mffikdlslnitlpsffgprmkqylktklleevegsctgkfgyilcvldydnidiqaefn
    vkyravvfkpfkgevvdgtvvscsqhgfevqvgpmkvfvtkhlmpqdltfnagsnppsyq
    ssedvitiksrirvkiegcisqvssihaigsikedylgai