PDB entry 1y12

View 1y12 on RCSB PDB site
Description: Structure of a hemolysin-coregulated protein from Pseudomonas aeruginosa
Class: structural genomics, unknown function
Keywords: Pseudomonas aeruginosa, hemolysin-corregulation, Structural Genomics, PSI, Protein Structure Initiative, Midwest Center for Structural Genomics, MCSG
Deposited on 2004-11-16, released 2005-01-25
The last revision prior to the SCOP 1.73 freeze date was dated 2006-10-24, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.182
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypothetical protein PA0085
    Species: Pseudomonas aeruginosa
    Gene: PA0085
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9I747 (Start-164)
      • modified residue (7)
      • modified residue (36)
      • modified residue (42)
      • modified residue (44)
      • modified residue (72-73)
    Domains in SCOP 1.73: d1y12a1
  • Chain 'B':
    Compound: hypothetical protein PA0085
    Species: Pseudomonas aeruginosa
    Gene: PA0085
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9I747 (Start-164)
      • modified residue (7)
      • modified residue (36)
      • modified residue (42)
      • modified residue (44)
      • modified residue (72-73)
    Domains in SCOP 1.73: d1y12b1
  • Chain 'C':
    Compound: hypothetical protein PA0085
    Species: Pseudomonas aeruginosa
    Gene: PA0085
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9I747 (Start-164)
      • modified residue (7)
      • modified residue (36)
      • modified residue (42)
      • modified residue (44)
      • modified residue (72-73)
    Domains in SCOP 1.73: d1y12c1
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1y12A (A:)
    snamavdmfikigdvkgeskdkthaeeidvlawswgmsqsgsmhmgggggagkvnvqdls
    ftkyidkstpnlmmacssgkhypqakltirkaggenqveyliitlkevlvssvstggsgg
    edrltenvtlnfaqvqvdyqpqkadgakdggpvkygwnirqnvqa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1y12A (A:)
    avdmfikigdvkgeskdkthaeeidvlawswgmsqsgsmhmggggagkvnvqdlsftkyi
    dkstpnlmmacssgkhypqakltirkaggenqveyliitlkevlvssvstggsggedrlt
    envtlnfaqvqvdyqpqkadgakdggpvkygwnirqnvqa
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1y12B (B:)
    snamavdmfikigdvkgeskdkthaeeidvlawswgmsqsgsmhmgggggagkvnvqdls
    ftkyidkstpnlmmacssgkhypqakltirkaggenqveyliitlkevlvssvstggsgg
    edrltenvtlnfaqvqvdyqpqkadgakdggpvkygwnirqnvqa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1y12B (B:)
    avdmfikigdvkgeskdkthaeeidvlawswgmsqsgsmhmagkvnvqdlsftkyidkst
    pnlmmacssgkhypqakltirkaggenqveyliitlkevlvssvstggsggedrltenvt
    lnfaqvqvdyqpqkadgakdggpvkygwnirqnvqa
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1y12C (C:)
    snamavdmfikigdvkgeskdkthaeeidvlawswgmsqsgsmhmgggggagkvnvqdls
    ftkyidkstpnlmmacssgkhypqakltirkaggenqveyliitlkevlvssvstggsgg
    edrltenvtlnfaqvqvdyqpqkadgakdggpvkygwnirqnvqa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1y12C (C:)
    avdmfikigdvkgeskdkthaeeidvlawswgmsqsgsmhmgggggagkvnvqdlsftky
    idkstpnlmmacssgkhypqakltirkaggenqveyliitlkevlvssvstggsggedrl
    tenvtlnfaqvqvdyqpqkadgakdggpvkygwnirqnvqa