PDB entry 1y11

View 1y11 on RCSB PDB site
Description: Mycobacterial adenylyl cyclase Rv1264, holoenzyme, active state
Deposited on 2004-11-16, released 2005-05-24
The last revision was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 3.3 Å
R-factor: 0.238
AEROSPACI score: 0.13 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hypothetical protein Rv1264/MT1302
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: Rv1264
    Database cross-references and differences (RAF-indexed):
  • Heterogens: SO4, 1PE, GOL

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >1y11A (A:)
    mtdhvreaddaniddllgdlggtaraeraklvewlleqgitpdeiratnpplllatrhlv
    gddgtyvsareisenygvdlellqrvqravglarvddpdavvhmradgeaaaraqrfvel
    glnpdqvvlvvrvlaeglshaaeamrytaleaimrpgateldiakgsqalvsqivpllgp
    miqdmlfmqlrhmmeteavnageraagkplpgarqvtvafadlvgftqlgevvsaeelgh
    lagrlaglardltappvwfiktigdavmlvcpdpaplldtvlklvevvdtdnnfprlrag
    vasgmavsragdwfgspvnvasrvtgvarpgavlvadsvrealgdapeadgfqwsfagpr
    rlrgirgdvrlfrvrrgatrtgsggaaqdddlagsspgsrshhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >1y11A (A:)
    ddllgdlggtaraeraklvewlleqgitpdeiratnpplllatrhlvgddgtyvsareis
    enygvdlellqrvqravglarvddpdavvhmradgeaaaraqrfvelglnpdqvvlvvrv
    laeglshaaeamrytaleaimrpgateldiakgsqalvsqivpllgpmiqdmlfmqlrhm
    meteavnageraagkplpgarqvtvafadlvgftqlgevvsaeelghlagrlaglardlt
    appvwfiktigdavmlvcpdpaplldtvlklvevvdtdnnfprlragvasgmavsragdw
    fgspvnvasrvtgvarpgavlvadsvrealgdapeadgfqwsfagprrlrgirgdvrlfr
    vrrg