PDB entry 1y10

View 1y10 on RCSB PDB site
Description: Mycobacterial adenylyl cyclase Rv1264, holoenzyme, inhibited state
Deposited on 2004-11-16, released 2005-05-24
The last revision was dated 2014-04-23, with a file datestamp of 2014-04-18.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.193
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hypothetical protein Rv1264/MT1302
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: Rv1264
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Hypothetical protein Rv1264/MT1302
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: Rv1264
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: Hypothetical protein Rv1264/MT1302
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: Rv1264
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: Hypothetical protein Rv1264/MT1302
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: Rv1264
    Database cross-references and differences (RAF-indexed):
  • Heterogens: CA, 1PE, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >1y10A (A:)
    mtdhvreaddaniddllgdlggtaraeraklvewlleqgitpdeiratnpplllatrhlv
    gddgtyvsareisenygvdlellqrvqravglarvddpdavvhmradgeaaaraqrfvel
    glnpdqvvlvvrvlaeglshaaeamrytaleaimrpgateldiakgsqalvsqivpllgp
    miqdmlfmqlrhmmeteavnageraagkplpgarqvtvafadlvgftqlgevvsaeelgh
    lagrlaglardltappvwfiktigdavmlvcpdpaplldtvlklvevvdtdnnfprlrag
    vasgmavsragdwfgspvnvasrvtgvarpgavlvadsvrealgdapeadgfqwsfagpr
    rlrgirgdvrlfrvrrgatrtgsggaaqdddlagsspgsrshhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >1y10A (A:)
    ddllgdlggtaraeraklvewlleqgitpdeiratnpplllatrhlvgddgtyvsareis
    enygvdlellqrvqravglarvddpdavvhmradgeaaaraqrfvelglnpdqvvlvvrv
    laeglshaaeamrytaleaimrpgateldiakgsqalvsqivpllgpmiqdmlfmqlrhm
    meteavnageraagkplpgarqvtvafadlvgftqlgevvsaeelghlagrlaglardlt
    appvwfiktigdavmlvcpdpaplldtvlklvevvdtdnnfprlragvasgmavsragdw
    fgspvnvasrvtgvarpgavlvadsvrealgdadgfqwsfagprrlrgirgdvrlfrvrr
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >1y10B (B:)
    mtdhvreaddaniddllgdlggtaraeraklvewlleqgitpdeiratnpplllatrhlv
    gddgtyvsareisenygvdlellqrvqravglarvddpdavvhmradgeaaaraqrfvel
    glnpdqvvlvvrvlaeglshaaeamrytaleaimrpgateldiakgsqalvsqivpllgp
    miqdmlfmqlrhmmeteavnageraagkplpgarqvtvafadlvgftqlgevvsaeelgh
    lagrlaglardltappvwfiktigdavmlvcpdpaplldtvlklvevvdtdnnfprlrag
    vasgmavsragdwfgspvnvasrvtgvarpgavlvadsvrealgdapeadgfqwsfagpr
    rlrgirgdvrlfrvrrgatrtgsggaaqdddlagsspgsrshhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >1y10B (B:)
    lggtaraeraklvewlleqgitpdeiratnpplllatrhlvgddgtyvsareisenygvd
    lellqrvqravglarvddpdavvhmradgeaaaraqrfvelglnpdqvvlvvrvlaegls
    haaeamrytaleaimrpgateldiakgsqalvsqivpllgpmiqdmlfmqlrhmmeteav
    nageraagkplpgarqvtvafadlvgftqlgevvsaeelghlagrlaglardltappvwf
    iktigdavmlvcpdpaplldtvlklvevvdtdnnfprlragvasgmavsragdwfgspvn
    vasrvtgvarpgavlvadsvrealgdapeadgfqwsfagprrlrgirgdvrlfrvrr
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >1y10C (C:)
    mtdhvreaddaniddllgdlggtaraeraklvewlleqgitpdeiratnpplllatrhlv
    gddgtyvsareisenygvdlellqrvqravglarvddpdavvhmradgeaaaraqrfvel
    glnpdqvvlvvrvlaeglshaaeamrytaleaimrpgateldiakgsqalvsqivpllgp
    miqdmlfmqlrhmmeteavnageraagkplpgarqvtvafadlvgftqlgevvsaeelgh
    lagrlaglardltappvwfiktigdavmlvcpdpaplldtvlklvevvdtdnnfprlrag
    vasgmavsragdwfgspvnvasrvtgvarpgavlvadsvrealgdapeadgfqwsfagpr
    rlrgirgdvrlfrvrrgatrtgsggaaqdddlagsspgsrshhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >1y10C (C:)
    niddllgdlggtaraeraklvewlleqgitpdeiratnpplllatrhlvgddgtyvsare
    isenygvdlellqrvqravglarvddpdavvhmradgeaaaraqrfvelglnpdqvvlvv
    rvlaeglshaaeamrytaleaimrpgateldiakgsqalvsqivpllgpmiqdmlfmqlr
    hmmeteavnageraagkplpgarqvtvafadlvgftqlgevvsaeelghlagrlaglard
    ltappvwfiktigdavmlvcpdpaplldtvlklvevvdtdnnfprlragvasgmavsrag
    dwfgspvnvasrvtgvarpgavlvadsvrealgdadgfqwsfagprrlrgirgdvrlfrv
    rrg
    

  • Chain 'D':
    Sequence, based on SEQRES records:
    >1y10D (D:)
    mtdhvreaddaniddllgdlggtaraeraklvewlleqgitpdeiratnpplllatrhlv
    gddgtyvsareisenygvdlellqrvqravglarvddpdavvhmradgeaaaraqrfvel
    glnpdqvvlvvrvlaeglshaaeamrytaleaimrpgateldiakgsqalvsqivpllgp
    miqdmlfmqlrhmmeteavnageraagkplpgarqvtvafadlvgftqlgevvsaeelgh
    lagrlaglardltappvwfiktigdavmlvcpdpaplldtvlklvevvdtdnnfprlrag
    vasgmavsragdwfgspvnvasrvtgvarpgavlvadsvrealgdapeadgfqwsfagpr
    rlrgirgdvrlfrvrrgatrtgsggaaqdddlagsspgsrshhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >1y10D (D:)
    ddllgdlggtaraeraklvewlleqgitpdeiratnpplllatrhlvgddgtyvsareis
    enygvdlellqrvqravglarvddpdavvhmradgeaaaraqrfvelglnpdqvvlvvrv
    laeglshaaeamrytaleaimrpgateldiakgsqalvsqivpllgpmiqdmlfmqlrhm
    meteavnageraagkplpgarqvtvafadlvgfevvsaeelghlagrlaglardltappv
    wfiktigdavmlvcpdpaplldtvlklvevvdtdnnfprlragvasgmavsragdwfgsp
    vnvasrvtgvarpgavlvadsvrealgdadgfqwsfagprrlrgirgdvrlfrvrr