PDB entry 1y0z

View 1y0z on RCSB PDB site
Description: X-ray structure of gene product from Arabidopsis thaliana At3g21360
Class: structural genomics, unknown function
Keywords: STRUCTURAL GENOMICS, PROTEIN STRUCTURE INITIATIVE, PSI, CESG, AT3G21360, Center for Eukaryotic Structural Genomics, UNKNOWN FUNCTION
Deposited on 2004-11-16, released 2004-11-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: N/A
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein product of AT3G21360
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: At3g21360
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1y0za_
  • Chain 'B':
    Compound: protein product of AT3G21360
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: At3g21360
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1y0zb_
  • Heterogens: SO4, FE2, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1y0zA (A:)
    maelllvetpipqqkhyeskpfpavisppsasipipalslplftqtiktqkhyldsllhe
    sgavlfrgfpvnsaddfndvveafgfdelpyvggaaprtsvvgrvftanesppdqkipfh
    hemaqvrefpsklffyceiepkcggetpivlshvvyermkdkhpefvqrleehgllyvrv
    lgedddpsspigrgwkstflthdknlaeqravdlgmklewtedggaktvmgpipaikyde
    srnrkvwfnsmvaaytgwedkrndprkavtfgdgkplpadivhdclrileeecvavpwqr
    gdvllidnwavlhsrrpfdpprrvlaslck
    

    Sequence, based on observed residues (ATOM records): (download)
    >1y0zA (A:)
    lllvetpipqqkhyeskpfpavispppalslplftqtiktqkhyldsllhesgavlfrgf
    pvnsaddfndvveafgfdelpyvggaaprtsvvgrvftanesppdqkipfhhemaqvref
    psklffyceiepkcggetpivlshvvyermkdkhpefvqrleehgllyvrvlgedddpss
    pigrgwkstflthdknlaeqravdlgmklewtedggaktvmgpipaikydesrnrkvwfn
    smvaaytgwedkrndprkavtfgdgkplpadivhdclrileeecvavpwqrgdvllidnw
    avlhsrrpfdpprrvlaslck
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1y0zB (B:)
    maelllvetpipqqkhyeskpfpavisppsasipipalslplftqtiktqkhyldsllhe
    sgavlfrgfpvnsaddfndvveafgfdelpyvggaaprtsvvgrvftanesppdqkipfh
    hemaqvrefpsklffyceiepkcggetpivlshvvyermkdkhpefvqrleehgllyvrv
    lgedddpsspigrgwkstflthdknlaeqravdlgmklewtedggaktvmgpipaikyde
    srnrkvwfnsmvaaytgwedkrndprkavtfgdgkplpadivhdclrileeecvavpwqr
    gdvllidnwavlhsrrpfdpprrvlaslck
    

    Sequence, based on observed residues (ATOM records): (download)
    >1y0zB (B:)
    aelllvetpipqqkhyeskpfpavisppsasipipalslplftqtiktqkhyldsllhes
    gavlfrgfpvnsaddfndvveafgfdelpytsvvgrvftanesppdqkipfhhemaqvre
    fpsklffyceiepkcggetpivlshvvyermkdkhpefvqrleehgllyvrvlgedddps
    spigrgwkstflthdknlaeqravdlgmklewtedggaktvmgpipaikydesrnrkvwf
    nsmvaaytgwedkrndprkavtfgdgkplpadivhdclrileeecvavpwqrgdvllidn
    wavlhsrrpfdpprrvlaslck