PDB entry 1y0x

View 1y0x on RCSB PDB site
Description: Thyroxine-Thyroid Hormone Receptor Interactions
Class: hormone/growth factor receptor
Keywords: HORMONE/GROWTH FACTOR RECEPTOR, HORMONE-GROWTH FACTOR RECEPTOR complex
Deposited on 2004-11-16, released 2004-12-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 3.1 Å
R-factor: N/A
AEROSPACI score: 0.13 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'X':
    Compound: Thyroid hormone receptor Beta-1
    Species: Homo sapiens [TaxId:9606]
    Gene: THRB, ERBA2, NR1A2, THR1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P10828 (21-End)
      • expression tag (18-20)
    Domains in SCOPe 2.07: d1y0xx1, d1y0xx2
  • Heterogens: CAC, T44, HOH

PDB Chain Sequences:

  • Chain 'X':
    Sequence, based on SEQRES records: (download)
    >1y0xX (X:)
    mgsshhhhhhssglvprgshmeelqksighkpeptdeeweliktvteahvatnaqgshwk
    qkrkflpedigqapivnapeggkvdleafshftkiitpaitrvvdfakklpmfcelpced
    qiillkgccmeimslraavrydpesetltlngemavtrgqlkngglgvvsdaifdlgmsl
    ssfnlddtevallqavllmssdrpglacveriekyqdsfllafehyinyrkhhvthfwpk
    llmkvtdlrmigachasrflhmkvecptelfpplflevfed
    

    Sequence, based on observed residues (ATOM records): (download)
    >1y0xX (X:)
    shmeelqksighkpeptdeeweliktvteahvatnaqgshwkqkrkflpedigvdleafs
    hftkiitpaitrvvdfakklpmfcelpcedqiillkgccmeimslraavrydpesetltl
    ngemavtrgqlkngglgvvsdaifdlgmslssfnlddtevallqavllmssdrpglacve
    riekyqdsfllafehyinyrkhhvthfwpkllmkvtdlrmigachasrflhmkvecptel
    fpplflevfe