PDB entry 1y0u

View 1y0u on RCSB PDB site
Description: Crystal Structure of the putative arsenical resistance operon repressor from Archaeoglobus fulgidus
Class: transcription repressor
Keywords: Structural Genomics, Protein Structure Initiative, PSI, Midwest Center For Structural Genomocs, MCSG, Arsenical Resistance Operon Repressor, HTH_ARSR, DNA-binding protein, Midwest Center for Structural Genomics
Deposited on 2004-11-16, released 2004-12-28
The last revision prior to the SCOP 1.73 freeze date was dated 2005-01-18, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.173
AEROSPACI score: 0.61 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: arsenical resistance operon repressor, putative
    Species: Archaeoglobus fulgidus
    Database cross-references and differences (RAF-indexed):
    • Uniprot O30069 (2-End)
      • cloning artifact (0-1)
      • modified residue (2)
      • modified residue (38)
      • modified residue (49)
    Domains in SCOP 1.73: d1y0ua_
  • Chain 'B':
    Compound: arsenical resistance operon repressor, putative
    Species: Archaeoglobus fulgidus
    Database cross-references and differences (RAF-indexed):
    • Uniprot O30069 (2-End)
      • cloning artifact (0-1)
      • modified residue (2)
      • modified residue (38)
      • modified residue (49)
    Domains in SCOP 1.73: d1y0ub_
  • Heterogens: ACT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1y0uA (A:)
    ghmsleewikadslekadeyhkrynyavtnpvrrkilrmldkgrseeeimqtlslskkql
    dyhlkvleagfciervgerwvvtdagkivdkirggs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1y0uA (A:)
    ghmsleewikadslekadeyhkrynyavtnpvrrkilrmldkgrseeeimqtlslskkql
    dyhlkvleagfciervgerwvvtdagkiv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1y0uB (B:)
    ghmsleewikadslekadeyhkrynyavtnpvrrkilrmldkgrseeeimqtlslskkql
    dyhlkvleagfciervgerwvvtdagkivdkirggs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1y0uB (B:)
    ghmsleewikadslekadeyhkrynyavtnpvrrkilrmldkgrseeeimqtlslskkql
    dyhlkvleagfciervgerwvvtdagki