PDB entry 1y0s

View 1y0s on RCSB PDB site
Description: Crystal structure of PPAR delta complexed with GW2331
Class: hormone/growth factor receptor
Keywords: ppar, hormone/growth factor receptor complex
Deposited on 2004-11-16, released 2005-03-29
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.65 Å
R-factor: 0.21
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Peroxisome proliferator activated receptor delta
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1y0sa_
  • Chain 'B':
    Compound: Peroxisome proliferator activated receptor delta
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1y0sb_
  • Heterogens: IOD, 331, B7G, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1y0sA (A:)
    pqvadlkafskhiynaylknfnmtkkkarsiltgkashtapfvihdietlwqaekglvwk
    qlvnglppykeisvhvfyrcqcttvetvreltefaksipsfsslflndqvtllkygvhea
    ifamlasivnkdgllvangsgfvtreflrslrkpfsdiiepkfefavkfnalelddsdla
    lfiaaiilcgdrpglmnvprveaiqdtilralefhlqanhpdaqylfpkllqkmadlrql
    vtehaqmmqrikktetetslhpllqeiykdmy
    

    Sequence, based on observed residues (ATOM records): (download)
    >1y0sA (A:)
    pqvadlkafskhiynaylknfnmtkkkarsiltgapfvihdietlwqaekglvwglppyk
    eisvhvfyrcqcttvetvreltefaksipsfsslflndqvtllkygvheaifamlasivn
    kdgllvangsgfvtreflrslrkpfsdiiepkfefavkfnalelddsdlalfiaaiilcg
    drpglmnvprveaiqdtilralefhlqanhpdaqylfpkllqkmadlrqlvtehaqmmqr
    ikktetetslhpllqeiykd
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1y0sB (B:)
    pqvadlkafskhiynaylknfnmtkkkarsiltgkashtapfvihdietlwqaekglvwk
    qlvnglppykeisvhvfyrcqcttvetvreltefaksipsfsslflndqvtllkygvhea
    ifamlasivnkdgllvangsgfvtreflrslrkpfsdiiepkfefavkfnalelddsdla
    lfiaaiilcgdrpglmnvprveaiqdtilralefhlqanhpdaqylfpkllqkmadlrql
    vtehaqmmqrikktetetslhpllqeiykdmy
    

    Sequence, based on observed residues (ATOM records): (download)
    >1y0sB (B:)
    adlkafskhiynaylknfnmtkkkarsiltgapfvihdietlwqaekglvwglppykeis
    vhvfyrcqcttvetvreltefaksipsfsslflndqvtllkygvheaifamlasivnkdg
    llvangsgfvtreflrslrkpfsdiiepkfefavkfnalelddsdlalfiaaiilcgdrp
    glmnvprveaiqdtilralefhlqanhpdaqylfpkllqkmadlrqlvtehaqmmqrikk
    tetetslhpllqeiykdm