PDB entry 1y0p

View 1y0p on RCSB PDB site
Description: Flavocytochrome c3 with mesaconate bound
Class: oxidoreductase
Keywords: fumarate reductase, flavocytochrome, mesaconate, OXIDOREDUCTASE
Deposited on 2004-11-16, released 2005-11-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.152
AEROSPACI score: 0.66 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Fumarate reductase flavoprotein subunit
    Species: Shewanella frigidimarina [TaxId:56812]
    Gene: fcca
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1y0pa1, d1y0pa2, d1y0pa3
  • Heterogens: NA, HEM, FAD, MEZ, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1y0pA (A:)
    adnlaefhvqnqecdschtpdgelsndsltyentqcvschgtlaevaettkhehynahas
    hfpgevactschsaheksmvycdschsfdfnmpyakkwlrdeptiaelakdkserqaala
    saphdtvdvvvvgsggagfsaaisatdsgakviliekepviggnaklaaggmnaawtdqq
    kakkitdspelmfedtmkggqnindpalvkvlsshskdsvdwmtamgadltdvgmmggas
    vnrahrptggagvgahvvqvlydnavkrnidlrmntrgievlkddkgtvkgilvkgmykg
    yywvkadavilatggfaknnervakldpslkgfistnqpgavgdgldvaenaggalkdmq
    yiqahptlsvkggvmvteavrgngailvnregkrfvneittrdkasaailaqtgksayli
    fddsvrkslskidkyiglgvaptadslvklgkmegidgkaltetvarynslvssgkdtdf
    erpnlpralnegnyyaievtpgvhhtmggvmidtkaevmnakkqvipglygagevtggvh
    ganrlggnaisdiitfgrlageeaakyskkn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1y0pA (A:)
    adnlaefhvqnqecdschtpdgelsndsltyentqcvschgtlaevaettkhehynahas
    hfpgevactschsaheksmvycdschsfdfnmpyakkwlrdeptiaelakdkserqaala
    saphdtvdvvvvgsggagfsaaisatdsgakviliekepviggnaklaaggmnaawtdqq
    kakkitdspelmfedtmkggqnindpalvkvlsshskdsvdwmtamgadltdvgmmggas
    vnrahrptggagvgahvvqvlydnavkrnidlrmntrgievlkddkgtvkgilvkgmykg
    yywvkadavilatggfaknnervakldpslkgfistnqpgavgdgldvaenaggalkdmq
    yiqahptlsvkggvmvteavrgngailvnregkrfvneittrdkasaailaqtgksayli
    fddsvrkslskidkyiglgvaptadslvklgkmegidgkaltetvarynslvssgkdtdf
    erpnlpralnegnyyaievtpgvhhtmggvmidtkaevmnakkqvipglygagevtggvh
    ganrlggnaisdiitfgrlageeaakys