PDB entry 1y0o

View 1y0o on RCSB PDB site
Description: crystal structure of reduced AtFKBP13
Class: isomerase
Keywords: Reduced AtFKBP13, FK-506 binding protein, ISOMERASE
Deposited on 2004-11-15, released 2005-11-01
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.89 Å
R-factor: 0.203
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: FKBP-type peptidyl-prolyl cis-trans isomerase 3
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: AtFKBP13
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1y0oa_
  • Chain 'B':
    Compound: FKBP-type peptidyl-prolyl cis-trans isomerase 3
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: AtFKBP13
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1y0ob_
  • Chain 'C':
    Compound: FKBP-type peptidyl-prolyl cis-trans isomerase 3
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: AtFKBP13
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1y0oc_
  • Chain 'D':
    Compound: FKBP-type peptidyl-prolyl cis-trans isomerase 3
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: AtFKBP13
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1y0od_
  • Chain 'E':
    Compound: FKBP-type peptidyl-prolyl cis-trans isomerase 3
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: AtFKBP13
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1y0oe_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1y0oA (A:)
    ettscefsvspsglafcdkvvgygpeavkgqlikahyvgklengkvfdssynrgkpltfr
    igvgevikgwdqgilgsdgippmltggkrtlrippelaygdrgagckggsclippasvll
    fdieyigka
    

    Sequence, based on observed residues (ATOM records): (download)
    >1y0oA (A:)
    cefsvspsglafcdkvvgygpeavkgqlikahyvgklengkvfdssynrgkpltfrigvg
    evikgwdqgilgsdgippmltggkrtlrippelaygdrgagckggsclippasvllfdie
    yigka
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1y0oB (B:)
    ettscefsvspsglafcdkvvgygpeavkgqlikahyvgklengkvfdssynrgkpltfr
    igvgevikgwdqgilgsdgippmltggkrtlrippelaygdrgagckggsclippasvll
    fdieyigka
    

    Sequence, based on observed residues (ATOM records): (download)
    >1y0oB (B:)
    cefsvspsglafcdkvvgygpeavkgqlikahyvgklengkvfdssynrgkpltfrigvg
    evikgwdqgilgsdgippmltggkrtlrippelaygdrgagckggsclippasvllfdie
    yigka
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1y0oC (C:)
    ettscefsvspsglafcdkvvgygpeavkgqlikahyvgklengkvfdssynrgkpltfr
    igvgevikgwdqgilgsdgippmltggkrtlrippelaygdrgagckggsclippasvll
    fdieyigka
    

    Sequence, based on observed residues (ATOM records): (download)
    >1y0oC (C:)
    cefsvspsglafcdkvvgygpeavkgqlikahyvgklengkvfdssynrgkpltfrigvg
    evikgwdqgilgsdgippmltggkrtlrippelaygdrgagckggsclippasvllfdie
    yigka
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1y0oD (D:)
    ettscefsvspsglafcdkvvgygpeavkgqlikahyvgklengkvfdssynrgkpltfr
    igvgevikgwdqgilgsdgippmltggkrtlrippelaygdrgagckggsclippasvll
    fdieyigka
    

    Sequence, based on observed residues (ATOM records): (download)
    >1y0oD (D:)
    cefsvspsglafcdkvvgygpeavkgqlikahyvgklengkvfdssynrgkpltfrigvg
    evikgwdqgilgsdgippmltggkrtlrippelaygdrgagckggsclippasvllfdie
    yigka
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1y0oE (E:)
    ettscefsvspsglafcdkvvgygpeavkgqlikahyvgklengkvfdssynrgkpltfr
    igvgevikgwdqgilgsdgippmltggkrtlrippelaygdrgagckggsclippasvll
    fdieyigka
    

    Sequence, based on observed residues (ATOM records): (download)
    >1y0oE (E:)
    cefsvspsglafcdkvvgygpeavkgqlikahyvgklengkvfdssynrgkpltfrigvg
    evikgwdqgilgsdgippmltggkrtlrippelaygdrgagckggsclippasvllfdie
    yigka