PDB entry 1y0n

View 1y0n on RCSB PDB site
Description: Structure of Protein of Unknown Function PA3463 from Pseudomonas aeruginosa PAO1
Class: structural genomics, unknown function
Keywords: MCSG, Midwest Center for Structural Genomics, Protein Structure Initiative, PSI, structural genomics, Pseudomonsa aeruginosa, hypothetical protein, UNKNOWN FUNCTION
Deposited on 2004-11-15, released 2004-12-21
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.248
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Hypothetical UPF0270 protein PA3463
  Species: PSEUDOMONAS AERUGINOSA [TaxId:208964]
  Gene: PA3463
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9HYE3 (2-77)
    • cloning artifact (0-1)
  Domains in SCOPe 2.08: d1y0na1, d1y0na2
• Heterogens: GOL, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >1y0nA (A:)
  ghmliphdlleadtlnnlledfvtregtdngdetpldvrverarhalrrgeavilfdpes
  qqcqlmlrsevpaellrd
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >1y0nA (A:)
  ghmliphdlleadtlnnlledfvtretpldvrverarhalrrgeavilfdpesqqcqlml
  rsevpaellrd