PDB entry 1y0n

View 1y0n on RCSB PDB site
Description: Structure of Protein of Unknown Function PA3463 from Pseudomonas aeruginosa PAO1
Class: structural genomics, unknown function
Keywords: MCSG, Midwest Center for Structural Genomics, Protein Structure Initiative, PSI, structural genomics, Pseudomonsa aeruginosa, hypothetical protein, UNKNOWN FUNCTION
Deposited on 2004-11-15, released 2004-12-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.248
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hypothetical UPF0270 protein PA3463
    Species: PSEUDOMONAS AERUGINOSA [TaxId:208964]
    Gene: PA3463
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9HYE3 (2-77)
      • cloning artifact (0-1)
    Domains in SCOPe 2.07: d1y0na1, d1y0na2
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1y0nA (A:)
    ghmliphdlleadtlnnlledfvtregtdngdetpldvrverarhalrrgeavilfdpes
    qqcqlmlrsevpaellrd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1y0nA (A:)
    ghmliphdlleadtlnnlledfvtretpldvrverarhalrrgeavilfdpesqqcqlml
    rsevpaellrd