PDB entry 1y0m

View 1y0m on RCSB PDB site
Description: Crystal structure of of the SH3 domain of phospholipase C Gamma-1
Class: hydrolase
Keywords: SH3 domain, HYDROLASE
Deposited on 2004-11-15, released 2006-02-21
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.2 Å
R-factor: 0.151
AEROSPACI score: 0.83 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase gamma 1
  Species: Rattus norvegicus [TaxId:10116]
  Gene: PLCG1
  Database cross-references and differences (RAF-indexed):
  • Uniprot P10686 (0-60)
    • engineered (3)
  Domains in SCOPe 2.05: d1y0ma_
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1y0mA (A:)
  tfksavkalfdykaqredeltftksaiiqnvekqdggwwrgdyggkkqlwfpsnyveemi
  n