PDB entry 1y0m

View 1y0m on RCSB PDB site
Description: Crystal structure of of the SH3 domain of phospholipase C Gamma-1
Class: hydrolase
Keywords: SH3 domain, HYDROLASE
Deposited on 2004-11-15, released 2006-02-21
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 1.2 Å
R-factor: N/A
AEROSPACI score: 0.66 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase gamma 1
    Species: Rattus norvegicus [TaxId:10116]
    Gene: PLCG1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P10686 (0-60)
      • engineered (3)
    Domains in SCOPe 2.08: d1y0ma_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1y0mA (A:)
    tfksavkalfdykaqredeltftksaiiqnvekqdggwwrgdyggkkqlwfpsnyveemi
    n