PDB entry 1y0l

View 1y0l on RCSB PDB site
Description: Catalytic elimination antibody 34E4 in complex with hapten
Class: immune system
Keywords: IMMUNOGLOBULIN, CATALYTIC ANTIBODY, CHIMERIC FAB, HAPTEN COMPLEX, immune system
Deposited on 2004-11-15, released 2005-04-05
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.204
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Catalytic Antibody Fab 34E4 Light chain
    Species: , [TaxId:10090,9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 1Y0L (0-215)
    Domains in SCOPe 2.03: d1y0la1, d1y0la2
  • Chain 'B':
    Compound: Catalytic Antibody Fab 34E4 Heavy chain
    Species: , [TaxId:10090,9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 1Y0L (0-225)
    Domains in SCOPe 2.03: d1y0lb1, d1y0lb2
  • Chain 'C':
    Compound: Catalytic Antibody Fab 34E4 Light chain
    Species: , [TaxId:10090,9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 1Y0L (0-215)
    Domains in SCOPe 2.03: d1y0lc1, d1y0lc2
  • Chain 'D':
    Compound: Catalytic Antibody Fab 34E4 Heavy chain
    Species: , [TaxId:10090,9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 1Y0L (0-225)
    Domains in SCOPe 2.03: d1y0ld1, d1y0ld2
  • Chain 'E':
    Compound: Catalytic Antibody Fab 34E4 Light chain
    Species: , [TaxId:10090,9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 1Y0L (0-215)
    Domains in SCOPe 2.03: d1y0le1, d1y0le2
  • Chain 'F':
    Compound: Catalytic Antibody Fab 34E4 Heavy chain
    Species: , [TaxId:10090,9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 1Y0L (0-225)
    Domains in SCOPe 2.03: d1y0lf1, d1y0lf2
  • Chain 'H':
    Compound: Catalytic Antibody Fab 34E4 Heavy chain
    Species: , [TaxId:10090,9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 1Y0L (0-225)
    Domains in SCOPe 2.03: d1y0lh1, d1y0lh2
  • Chain 'L':
    Compound: Catalytic Antibody Fab 34E4 Light chain
    Species: , [TaxId:10090,9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 1Y0L (0-215)
    Domains in SCOPe 2.03: d1y0ll1, d1y0ll2
  • Heterogens: CL, HAN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1y0lA (A:)
    elvvtqesalttspgetvtltcrsssgavttsnyatwvqekpdhlftgliggtnkrapgv
    parfsgsligdraaltitgaqtedeaiyfcalwnsnhlvfgggtkleikrtvaapsvfif
    ppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsst
    ltlskadyekhkvyacevthqglsspvtksfnrgec
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1y0lB (B:)
    evkllesggglaqpggslklscaasgfdfrrywmtwvrqapgkglewigeinpdsrtiny
    mpslkdkfiisrdnaknslylqlsrlrsedsalyycvrldfdvynhyyvldywgqgtsvt
    vssastkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavl
    qssglyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepksc
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1y0lC (C:)
    elvvtqesalttspgetvtltcrsssgavttsnyatwvqekpdhlftgliggtnkrapgv
    parfsgsligdraaltitgaqtedeaiyfcalwnsnhlvfgggtkleikrtvaapsvfif
    ppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsst
    ltlskadyekhkvyacevthqglsspvtksfnrgec
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1y0lD (D:)
    evkllesggglaqpggslklscaasgfdfrrywmtwvrqapgkglewigeinpdsrtiny
    mpslkdkfiisrdnaknslylqlsrlrsedsalyycvrldfdvynhyyvldywgqgtsvt
    vssastkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavl
    qssglyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepksc
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1y0lE (E:)
    elvvtqesalttspgetvtltcrsssgavttsnyatwvqekpdhlftgliggtnkrapgv
    parfsgsligdraaltitgaqtedeaiyfcalwnsnhlvfgggtkleikrtvaapsvfif
    ppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsst
    ltlskadyekhkvyacevthqglsspvtksfnrgec
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1y0lF (F:)
    evkllesggglaqpggslklscaasgfdfrrywmtwvrqapgkglewigeinpdsrtiny
    mpslkdkfiisrdnaknslylqlsrlrsedsalyycvrldfdvynhyyvldywgqgtsvt
    vssastkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavl
    qssglyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepksc
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1y0lH (H:)
    evkllesggglaqpggslklscaasgfdfrrywmtwvrqapgkglewigeinpdsrtiny
    mpslkdkfiisrdnaknslylqlsrlrsedsalyycvrldfdvynhyyvldywgqgtsvt
    vssastkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavl
    qssglyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepksc
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1y0lL (L:)
    elvvtqesalttspgetvtltcrsssgavttsnyatwvqekpdhlftgliggtnkrapgv
    parfsgsligdraaltitgaqtedeaiyfcalwnsnhlvfgggtkleikrtvaapsvfif
    ppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsst
    ltlskadyekhkvyacevthqglsspvtksfnrgec