PDB entry 1y0k

View 1y0k on RCSB PDB site
Description: Structure of Protein of Unknown Function PA4535 from Pseudomonas aeruginosa strain PAO1, Monooxygenase Superfamily
Class: structural genomics, unknown function
Keywords: structural genomics, Midwest Center for Structural Genomics, MCSG, Pseudomonas aeuruginosa PAo1, Protein Structure Initiative, PSI, hypothetical protein, UNKNOWN FUNCTION
Deposited on 2004-11-15, released 2005-01-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-11-26, with a file datestamp of 2014-11-21.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: 0.188
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypothetical protein PA4535
    Species: PSEUDOMONAS AERUGINOSA [TaxId:208964]
    Gene: PA4535
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9HVP2 (0-208)
      • modified residue (0)
      • modified residue (173)
    Domains in SCOPe 2.07: d1y0ka1
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1y0kA (A:)
    mneadylrlltrqaeqandflsnarkwdrerwvcqrflealnvpyrqedfaapgeqppdv
    lfkgagfevffvldegrrlneewreeltrrrqavslrqlirreerpqriaaaelqarlap
    tlrkkahnysergidhgeldllafvnlkravpdfntpfpppteylrqgwrslsmvgptfa
    rvlfahsgapeflranlgrsilfdagvgl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1y0kA (A:)
    mneadylrlltrqaeqandflsnarkwdrerwvcqrflealnvpyrqedfaapgeqppdv
    lfkgagfevffvlderpqriaaaelqarlaptlrkkahnysergidhgeldllafvnlkr
    avpdfntpfpppteylrqgwrslsmvgptfarvlfahsgapeflranlgrsilfdagvgl