PDB entry 1y0j

View 1y0j on RCSB PDB site
Description: Zinc fingers as protein recognition motifs: structural basis for the GATA-1/Friend of GATA interaction
Class: DNA binding protein
Keywords: zinc finger, GATA-1, FOG, protein-protein complex
Deposited on 2004-11-15, released 2005-01-25
The last revision prior to the SCOP 1.73 freeze date was dated 2005-01-25, with a file datestamp of 2007-06-04.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Erythroid transcription factor
  Species: MUS MUSCULUS
  Gene: gata-1
  Database cross-references and differences (RAF-indexed):
  • Uniprot P17679 (2-End)
  Domains in SCOP 1.73: d1y0ja1
• Chain 'B':
  Compound: Zinc-finger protein ush
  Species: Drosophila melanogaster
  Gene: U-shaped
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9VPQ6 (2-35)
    • cloning artifact (0-1)
  Domains in SCOP 1.73: d1y0jb1
• Heterogens: ZN

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >1y0jA (A:)
  gsearecvncgatatplwrrdrtghylcnacglyhkmngqnrplir
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >1y0jA (A:)
  earecvncgatatplwrrdrtghylcnacglyhkmngqn
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1y0jB (B:)
  gsllkparfmclpcgiafsspstleahqayycshri