PDB entry 1y0h

View 1y0h on RCSB PDB site
Description: Structure of Rv0793 from Mycobacterium tuberculosis
Class: structural genomics, unknown function
Keywords: ferredoxin-like fold, alpha+beta sandwich with antiparallel beta-sheet, Structural Genomics, PSI, Protein Structure Initiative, TB Structural Genomics Consortium, TBSGC
Deposited on 2004-11-15, released 2004-12-28
The last revision prior to the SCOP 1.73 freeze date was dated 2006-05-16, with a file datestamp of 2007-07-20.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.202
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypothetical protein Rv0793
    Species: Mycobacterium tuberculosis
    Gene: Rv0793
    Database cross-references and differences (RAF-indexed):
    • Uniprot O86332 (1-End)
      • insertion (0)
    Domains in SCOP 1.73: d1y0ha_
  • Chain 'B':
    Compound: hypothetical protein Rv0793
    Species: Mycobacterium tuberculosis
    Gene: Rv0793
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1y0hb_
  • Heterogens: ACT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1y0hA (A:)
    gmtspvaviarfmprpdarsalralldamitptraedgcrsydlyesadggelvlferyr
    srialdehrgsphylnyraqvgelltrpvavtvlapldeasa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1y0hA (A:)
    gmtspvaviarfmprpdarsalralldamitptraedgcrsydlyesadggelvlferyr
    srialdehrgsphylnyraqvgelltrpvavtvlapldeas
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1y0hB (B:)
    gmtspvaviarfmprpdarsalralldamitptraedgcrsydlyesadggelvlferyr
    srialdehrgsphylnyraqvgelltrpvavtvlapldeasa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1y0hB (B:)
    spvaviarfmprpdarsalralldamitptraedgcrsydlyesadggelvlferyrsri
    aldehrgsphylnyraqvgelltrpvavtvlapldeas