PDB entry 1y0g

View 1y0g on RCSB PDB site
Description: crystal structure of the escherichia coli ycei protein, structural genomics
Class: lipid binding protein
Keywords: Lipid Binding Protein, lipocalin, cofactor, coenzyme, dehydrogenase, hydrolase, predicted, Structural Genomics, Protein Structure Initiative, PSI, NYSGXRC, New York Structural GenomiX Research Consortium
Deposited on 2004-11-15, released 2004-12-21
The last revision prior to the SCOP 1.73 freeze date was dated 2005-01-25, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.228
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein yceI
    Species: Escherichia coli
    Gene: yceI
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1y0ga_
  • Chain 'B':
    Compound: Protein yceI
    Species: Escherichia coli
    Gene: yceI
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1y0gb_
  • Chain 'C':
    Compound: Protein yceI
    Species: Escherichia coli
    Gene: yceI
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1y0gc_
  • Chain 'D':
    Compound: Protein yceI
    Species: Escherichia coli
    Gene: yceI
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1y0gd_
  • Heterogens: 8PP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1y0gA (A:)
    mkksllgltfaslmfsagsavaadykidkegqhafvnfriqhlgyswlygtfkdfdgtft
    fdeknpaadkvnvtinttsvdtnhaerdkhlrsadflntakypqatftstsvkkdgdeld
    itgdltlngvtkpvtleakligqgddpwggkragfeaegkiklkdfniktdlgpasqevd
    liisvegvqqk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1y0gA (A:)
    adykidkegqhafvnfriqhlgyswlygtfkdfdgtftfdeknpaadkvnvtinttsvdt
    nhaerdkhlrsadflntakypqatftstsvkkdgdelditgdltlngvtkpvtleaklig
    qgddpwggkragfeaegkiklkdfniktdlgpasqevdliisvegvqqk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1y0gB (B:)
    mkksllgltfaslmfsagsavaadykidkegqhafvnfriqhlgyswlygtfkdfdgtft
    fdeknpaadkvnvtinttsvdtnhaerdkhlrsadflntakypqatftstsvkkdgdeld
    itgdltlngvtkpvtleakligqgddpwggkragfeaegkiklkdfniktdlgpasqevd
    liisvegvqqk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1y0gB (B:)
    adykidkegqhafvnfriqhlgyswlygtfkdfdgtftfdeknpaadkvnvtinttsvdt
    nhaerdkhlrsadflntakypqatftstsvkkdgdelditgdltlngvtkpvtleaklig
    qgddpwggkragfeaegkiklkdfniktdlgpasqevdliisvegvqqk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1y0gC (C:)
    mkksllgltfaslmfsagsavaadykidkegqhafvnfriqhlgyswlygtfkdfdgtft
    fdeknpaadkvnvtinttsvdtnhaerdkhlrsadflntakypqatftstsvkkdgdeld
    itgdltlngvtkpvtleakligqgddpwggkragfeaegkiklkdfniktdlgpasqevd
    liisvegvqqk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1y0gC (C:)
    adykidkegqhafvnfriqhlgyswlygtfkdfdgtftfdeknpaadkvnvtinttsvdt
    nhaerdkhlrsadflntakypqatftstsvkkdgdelditgdltlngvtkpvtleaklig
    qgddpwggkragfeaegkiklkdfniktdlgpasqevdliisvegvqqk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1y0gD (D:)
    mkksllgltfaslmfsagsavaadykidkegqhafvnfriqhlgyswlygtfkdfdgtft
    fdeknpaadkvnvtinttsvdtnhaerdkhlrsadflntakypqatftstsvkkdgdeld
    itgdltlngvtkpvtleakligqgddpwggkragfeaegkiklkdfniktdlgpasqevd
    liisvegvqqk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1y0gD (D:)
    adykidkegqhafvnfriqhlgyswlygtfkdfdgtftfdeknpaadkvnvtinttsvdt
    nhaerdkhlrsadflntakypqatftstsvkkdgdelditgdltlngvtkpvtleaklig
    qgddpwggkragfeaegkiklkdfniktdlgpasqevdliisvegvqqk