PDB entry 1y0f

View 1y0f on RCSB PDB site
Description: The structure of collagen type I. Single type I collagen molecule
Deposited on 2004-11-15, released 2006-05-16
The last revision was dated 2009-07-14, with a file datestamp of 2009-07-10.
Experiment type: FIBER
Resolution: 5.16 Å
R-factor: 0.096
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: collagen I alpha 1
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: collagen I alpha 2
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: collagen I alpha 1
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed):

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >1y0fA (A:)
    emsygydekstgisvpgpmgpsgprglpgppgapgpqgfqgppgepgepgasgpmgprgp
    pgppgkngddgeagkpgrpgergppgpqgarglpgtaglpgmkghrgfsgldgakgdagp
    agpkgepgspgengapgqmgprglpgergrpgapgpagargndgaagaagppgptgptgp
    pgfpgavgakgeagpegargsegpqgvrgepgppgpagaagpagnpgadgqpgakganga
    pgiagapgfpgargpsgpegpsgapgpkgnsgepgapgnkgdtgakgepgpagvqgppgp
    ageegkrgargepgpsglpgppgerggpgsrgfpgadgvagpkgpagergspgpagpkgs
    pgeagrpgeaglpgakgltgspgspgpdgktgppgpagedgrpgpagppgargqagvmgf
    pgpkgaagepgkagergvpgppgavgpagkdgeagaqgppgpagpagergeqgpagspgf
    qglpgpagppgeagkpgeqgvpgdlgapgpsgargergfpgergvegppgpagprganga
    pgndgakgdagapgapgsqgapglqgmpgergaaglpgpkgdrgdagpkgadgapgkdgv
    rgltgpigppgpagapgdkgeagpsgpagptgargapgdrgepgppgpagfagppgadgq
    pgakgepgdagakgdagppgpagpagppgpignvgapgpkgargsagppgatgfpgaagr
    vgppgpsgnagppgppgpagkegskgprgetgpagrpgevgppgppgpagekgapgadgp
    agapgtpgpqgiagqrgvvglpgqrgergfpglpgpsgepgkqgpsgasgergppgpmgp
    pglagppgesgregapgaegspgrdgspgakgdrgetgpagppgapgapgapgpvgpagk
    sgdrgetgpagpigpvgpagargpagpqgprgdkgetgeegdrgikghrgfsglqgppgp
    pgspgeqgpsgasgpagprgppgsagspgkdglnglpgpigppgprgrtgdagpagppgp
    pgppgppgppsggydlsflpqppqqkahdkgryy
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records:
    >1y0fB (B:)
    efdakgggpgpmglmgprgppgasgapgpqgfqgppgepgepgqtgpagargppgppgka
    gedghpgkpgrpgergvpgpqgargfpgtpglpgfkgirghngldgltgqpgapgvkgep
    gapgengtpgqkgarglpgergrvgapgpagargsdgsvgpvgpagpigsagppgfpgap
    gpkgelgpvgnpgpagpagprgevglpglsgpvgppgnagpnglpgakgaaglpgvagap
    glpgprgipgpvgaagatgarglvgepgpagskgesgnkgepgavgqpgppgpsgeegkr
    gstgeigpagppgppglrgnpgsrglpgadgvagvmgpagsrgtsgpagvrgpngdsgrp
    gepglmgprgfpgspgnigpagkegpvglpgidgrpgpigpagprgeagaigfpgpkgpt
    gepgkpgekgnvglagargapgpdgnngaqgppglqgvqgekgeqgpagppgfqglpgpa
    gpageagkpgerglhgefglpgpagargergppgergaagptgpigsrgpsgppgpdgnk
    geagavgpagapgpagppgipgergvagvpggkgekgapglrgdtgatgrdgarglpgai
    gapgpaggagdrgeggpagpagpagargirgergepgpvgpsgfagpagaagqpgakger
    gtkgpvgeqgpvgpqgpvgaagppgpvgaagpagprgdagptgmtgfpgaagrtgppgps
    gltgppgppgaagkegirgprgdqgpvgrsgetgatgptgfvgekgptgepgsagppgpp
    gpqgllgapgflglpgsrgerglpgvagsvgepgplgiagppgargppgnvgnpgvngap
    geagrdgnpgndgppgrdgqpghkgergtpgnagppgavgpvgpvgepgklgnrgepgpa
    gavgpagavgprgpsgpqgirgddgepgdkgdkgikgdrghnglqglpglaghhgdqgap
    gavgpagprgpagpsgpagkigrigavgpagaagirgsqgsqgpagppgppgppgppgpp
    sggyef
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records:
    >1y0fC (C:)
    emsygydekstgisvpgpmgpsgprglpgppgapgpqgfqgppgepgepgasgpmgprgp
    pgppgkngddgeagkpgrpgergppgpqgarglpgtaglpgmkghrgfsgldgakgdagp
    agpkgepgspgengapgqmgprglpgergrpgapgpagargndgaagaagppgptgptgp
    pgfpgavgakgeagpegargsegpqgvrgepgppgpagaagpagnpgadgqpgakganga
    pgiagapgfpgargpsgpegpsgapgpkgnsgepgapgnkgdtgakgepgpagvqgppgp
    ageegkrgargepgpsglpgppgerggpgsrgfpgadgvagpkgpagergspgpagpkgs
    pgeagrpgeaglpgakgltgspgspgpdgktgppgpagedgrpgpagppgargqagvmgf
    pgpkgaagepgkagergvpgppgavgpagkdgeagaqgppgpagpagergeqgpagspgf
    qglpgpagppgeagkpgeqgvpgdlgapgpsgargergfpgergvegppgpagprganga
    pgndgakgdagapgapgsqgapglqgmpgergaaglpgpkgdrgdagpkgadgapgkdgv
    rgltgpigppgpagapgdkgeagpsgpagptgargapgdrgepgppgpagfagppgadgq
    pgakgepgdagakgdagppgpagpagppgpignvgapgpkgargsagppgatgfpgaagr
    vgppgpsgnagppgppgpagkegskgprgetgpagrpgevgppgppgpagekgapgadgp
    agapgtpgpqgiagqrgvvglpgqrgergfpglpgpsgepgkqgpsgasgergppgpmgp
    pglagppgesgregapgaegspgrdgspgakgdrgetgpagppgapgapgapgpvgpagk
    sgdrgetgpagpigpvgpagargpagpqgprgdkgetgeegdrgikghrgfsglqgppgp
    pgspgeqgpsgasgpagprgppgsagspgkdglnglpgpigppgprgrtgdagpagppgp
    pgppgppgppsggydlsflpqppqqkahdkgryy