PDB entry 1y0b

View 1y0b on RCSB PDB site
Description: Crystal Structure of Xanthine Phosphoribosyltransferase from Bacillus subtilis.
Class: transferase
Keywords: xanthine, purine metabolism, phosphoribosyltransferase, structural genomics, PSI, Protein Structure Initative, Midwest Center for Structural Genomics, MCSG, Protein Structure Initiative, TRANSFERASE
Deposited on 2004-11-15, released 2005-02-22
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.181
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Xanthine phosphoribosyltransferase
    Species: Bacillus subtilis [TaxId:1423]
    Gene: xpt
    Database cross-references and differences (RAF-indexed):
    • Uniprot P42085 (3-End)
      • cloning artifact (1-2)
      • modified residue (3)
      • modified residue (37)
      • modified residue (69)
    Domains in SCOPe 2.06: d1y0ba1, d1y0ba2
  • Chain 'B':
    Compound: Xanthine phosphoribosyltransferase
    Species: Bacillus subtilis [TaxId:1423]
    Gene: xpt
    Database cross-references and differences (RAF-indexed):
    • Uniprot P42085 (3-End)
      • cloning artifact (0-2)
      • modified residue (3)
      • modified residue (37)
      • modified residue (69)
    Domains in SCOPe 2.06: d1y0bb2, d1y0bb3
  • Chain 'C':
    Compound: Xanthine phosphoribosyltransferase
    Species: Bacillus subtilis [TaxId:1423]
    Gene: xpt
    Database cross-references and differences (RAF-indexed):
    • Uniprot P42085 (3-End)
      • cloning artifact (0-2)
      • modified residue (3)
      • modified residue (37)
      • modified residue (69)
    Domains in SCOPe 2.06: d1y0bc2, d1y0bc3
  • Chain 'D':
    Compound: Xanthine phosphoribosyltransferase
    Species: Bacillus subtilis [TaxId:1423]
    Gene: xpt
    Database cross-references and differences (RAF-indexed):
    • Uniprot P42085 (3-End)
      • cloning artifact (0-2)
      • modified residue (3)
      • modified residue (37)
      • modified residue (69)
    Domains in SCOPe 2.06: d1y0bd2, d1y0bd3
  • Heterogens: NA, G4P, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1y0bA (A:)
    snamealkrkieeegvvlsdqvlkvdsflnhqidpllmqrigdefasrfakdgitkivti
    essgiapavmtglklgvpvvfarkhksltltdnlltasvysftkqtesqiavsgthlsdq
    dhvliiddflangqaahglvsivkqagasiagigivieksfqpgrdelvklgyrveslar
    iqsleegkvsfvqevhs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1y0bA (A:)
    namealkrkieeegvvlsdqvlkvdsflnhqidpllmqrigdefasrfakdgitkivtie
    ssgiapavmtglklgvpvvfarkhksltltdnlltasvysftkqtesqiavsgthlsdqd
    hvliiddflangqaahglvsivkqagasiagigivieksfqpgrdelvklgyrveslari
    qsleegkvsfvqe
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1y0bB (B:)
    snamealkrkieeegvvlsdqvlkvdsflnhqidpllmqrigdefasrfakdgitkivti
    essgiapavmtglklgvpvvfarkhksltltdnlltasvysftkqtesqiavsgthlsdq
    dhvliiddflangqaahglvsivkqagasiagigivieksfqpgrdelvklgyrveslar
    iqsleegkvsfvqevhs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1y0bB (B:)
    snamealkrkieeegvvlsdqvlkvdsflnhqidpllmqrigdefasrfakdgitkivti
    essgiapavmtglklgvpvvfarkhksltltdnlltasvysftesqiavsgthlsdqdhv
    liiddflangqaahglvsivkqagasiagigivieksfqpgrdelvklgyrveslariqs
    leegkvsfvqev
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1y0bC (C:)
    snamealkrkieeegvvlsdqvlkvdsflnhqidpllmqrigdefasrfakdgitkivti
    essgiapavmtglklgvpvvfarkhksltltdnlltasvysftkqtesqiavsgthlsdq
    dhvliiddflangqaahglvsivkqagasiagigivieksfqpgrdelvklgyrveslar
    iqsleegkvsfvqevhs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1y0bC (C:)
    snamealkrkieeegvvlsdqvlkvdsflnhqidpllmqrigdefasrfakdgitkivti
    essgiapavmtglklgvpvvfarkhksltltdnlltasvysftesqiavsgthlsdqdhv
    liiddflangqaahglvsivkqagasiagigivieksfqpgrdelvklgyrveslariqs
    leegkvsfv
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1y0bD (D:)
    snamealkrkieeegvvlsdqvlkvdsflnhqidpllmqrigdefasrfakdgitkivti
    essgiapavmtglklgvpvvfarkhksltltdnlltasvysftkqtesqiavsgthlsdq
    dhvliiddflangqaahglvsivkqagasiagigivieksfqpgrdelvklgyrveslar
    iqsleegkvsfvqevhs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1y0bD (D:)
    snamealkrkieeegvvlsdqvlkvdsflnhqidpllmqrigdefasrfakdgitkivti
    essgiapavmtglklgvpvvfarkhksltltdnlltasvysftkqtesqiavsgthlsdq
    dhvliiddflangqaahglvsivkqagasiagigivieksfqpgrdelvklgyrveslar
    iqsleegkvsfvqe