PDB entry 1y08

View 1y08 on RCSB PDB site
Description: structure of the streptococcal endopeptidase ides, a novel cysteine proteinase with strict specificity for igg
Deposited on 2004-11-15, released 2004-12-21
The last revision prior to the SCOP 1.71 freeze date was dated 2005-01-11, with a file datestamp of 2005-01-11.
Experiment type: XRAY
Resolution: 1.93 Å
R-factor: 0.196
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1y08a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1y08A (A:)
    mgsshhhhhhssglvprgshmirysevtpyhvtsvwtkgvtppanftqgedvfhapyvan
    qgwyditktfngkddllsgaatagnmlhwwfdqnkdqikryleehpekqkinfngeqmfd
    vkeaidtknhqldsklfeyfkekafpylstkhlgvfpdhvidmfingyrlsltnhgptpv
    kegskdprggifdavftrgdqsklltsrhdfkeknlkeisdlikkeltegkalglshtya
    nvrinhvinlwgadfdsngnlkaiyvtdsdsnasigmkkyfvgvnsagkvaisakeiked
    nigaqvlglftlstgqdswnqtn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1y08A (A:)
    tsvwtkgvtppanftqgedvfhapyvanqgwyditktfngkddllsgaatagnmlhwwfd
    qnkdqikryleehpekqkinfngeqmfdvkeaidtknhqldsklfeyfkekafpylkhlg
    vfpdhvidmfingyrlsltnhgptpvkegskdprggifdavftrgdqsklltsrhdfkek
    nlkeisdlikkeltegkalglshtyrinhvinlwgadfdsngnlkaiyvtdsdsnasigm
    kkyfvgvnsagkvaisakeikednigaqvlglftlstgqdswnqtn