PDB entry 1y07

View 1y07 on RCSB PDB site
Description: crystal structure of the superoxide reductase from treponema pallidum
Deposited on 2004-11-15, released 2005-11-22
The last revision was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 1.55 Å
R-factor: N/A
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: desulfoferrodoxin (rbo)
    Species: Treponema pallidum [TaxId:243276]
    Gene: TP0823
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: desulfoferrodoxin (rbo)
    Species: Treponema pallidum [TaxId:243276]
    Gene: TP0823
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: desulfoferrodoxin (rbo)
    Species: Treponema pallidum [TaxId:243276]
    Gene: TP0823
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: desulfoferrodoxin (rbo)
    Species: Treponema pallidum [TaxId:243276]
    Gene: TP0823
    Database cross-references and differences (RAF-indexed):
  • Heterogens: FE, MG, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >1y07A (A:)
    mgrelsfflqkesagfflgmdapagssvacgsevlravpvgtvdaakekhipvvevhghe
    vkvkvgsvahpmtpehyiawvclktrkgiqlkelpvdgapevtfaltaddqvleayefcn
    lhgvwsgk
    

    Sequence, based on observed residues (ATOM records):
    >1y07A (A:)
    relsfflqfflgmdapagssvacgsevlravpvgtvdaakekhipvvevhghevkvkvgs
    vahpmtpehyiawvclktrkgiqlkelpvdgapevtfaltaddqvleayefcnlhgvwsg
    k
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >1y07B (B:)
    mgrelsfflqkesagfflgmdapagssvacgsevlravpvgtvdaakekhipvvevhghe
    vkvkvgsvahpmtpehyiawvclktrkgiqlkelpvdgapevtfaltaddqvleayefcn
    lhgvwsgk
    

    Sequence, based on observed residues (ATOM records):
    >1y07B (B:)
    grelsfflqagfflgmdapagssvacgsevlravpvgdaakekhipvvevhghevkvkvg
    svahpmtpehyiawvclktrkgiqlkelpvdgapevtfaltaddqvleayefcnlhgvws
    gk
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >1y07C (C:)
    mgrelsfflqkesagfflgmdapagssvacgsevlravpvgtvdaakekhipvvevhghe
    vkvkvgsvahpmtpehyiawvclktrkgiqlkelpvdgapevtfaltaddqvleayefcn
    lhgvwsgk
    

    Sequence, based on observed residues (ATOM records):
    >1y07C (C:)
    mgrelsfflqkesagfflgmdapagssvacgsevlravpvgakekhipvvevhghevkvk
    vgsvahpmtpehyiawvclktrkgiqlkelpvdgapevtfaltaddqvleayefcnlhgv
    wsgk
    

  • Chain 'D':
    Sequence, based on SEQRES records:
    >1y07D (D:)
    mgrelsfflqkesagfflgmdapagssvacgsevlravpvgtvdaakekhipvvevhghe
    vkvkvgsvahpmtpehyiawvclktrkgiqlkelpvdgapevtfaltaddqvleayefcn
    lhgvwsgk
    

    Sequence, based on observed residues (ATOM records):
    >1y07D (D:)
    grelsfflqkesagfflgmdapagssvacgsevlravpvgtvdkhipvvevhghevkvkv
    gsvahpmtpehyiawvclktrkgiqlkelpvdgapevtfaltaddqvleayefcnlhgvw
    sgk