PDB entry 1y02

View 1y02 on RCSB PDB site
Description: Crystal Structure of a FYVE-type domain from caspase regulator CARP2
Deposited on 2004-11-14, released 2004-12-28
The last revision prior to the SCOP 1.71 freeze date was dated 2004-12-28, with a file datestamp of 2004-12-28.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.206
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1y02A (A:)
    mqaysnpgyssfpsptglepsckscgahfantarkqtcldckknfcmtcssqvgngprlc
    llcqrfratafqreelmkmkvkdlrdylslhdistemcrekeelvllvlgqqpvisqedr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1y02A (A:)
    psckscgahfantarkqtcldckknfcmtcssqprlcllcqrfratafqreelmkmkvkd
    lrdylslhdistemcrekeelvllvlgqqpv