PDB entry 1y00

View 1y00 on RCSB PDB site
Description: Solution structure of the Carbon Storage Regulator protein CsrA
Class: RNA binding protein
Keywords: Carbon storage regulation, Montreal-Kingston Bacterial Structural Genomics Initiative, BSGI, Structural Genomics, RNA BINDING PROTEIN
Deposited on 2004-11-13, released 2005-06-21
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Carbon storage regulator
    Species: Escherichia coli [TaxId:562]
    Gene: csrA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1y00a_
  • Chain 'B':
    Compound: Carbon storage regulator
    Species: Escherichia coli [TaxId:562]
    Gene: csrA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1y00b_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1y00A (A:)
    mliltrrvgetlmigdevtvtvlgvkgnqvrigvnapkevsvhreeiyqriqaeksqqss
    y
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1y00B (B:)
    mliltrrvgetlmigdevtvtvlgvkgnqvrigvnapkevsvhreeiyqriqaeksqqss
    y