PDB entry 1xzz

View 1xzz on RCSB PDB site
Description: Crystal structure of the ligand binding suppressor domain of type 1 inositol 1,4,5-trisphosphate receptor
Class: membrane protein
Keywords: ip3 receptor, ip3 receptor suppressor domain, calcium channel, b-trefoil fold, membrane protein
Deposited on 2004-11-13, released 2005-01-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.205
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Inositol 1,4,5-trisphosphate receptor type 1
    Species: Mus musculus [TaxId:10090]
    Gene: Itpr1, Insp3r, Pcd6, Pcp1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P11881 (Start-237)
      • expression tag (238-242)
    Domains in SCOPe 2.07: d1xzza1, d1xzza2
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xzzA (A:)
    masmtggqqmgrgsefsdkmssflhigdicslyaegstngfistlglvddrcvvqpeagd
    lnnppkkfrdclfklcpmnrysaqkqfwkaakpgansttdavllnklhhaadlekkqnet
    enrkllgtviqygnviqllhlksnkyltvnkrlpalleknamrvtldeagnegswfyiqp
    fyklrsigdsvvigdkvvlnpvnagqplhasshqlvdnpgcnevnsvncntswkivlfle
    hhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xzzA (A:)
    sflhigdicslyaegstngfistlglvddrcvvqpeagdlnnppkkfrdclfklcpmnry
    saqkqfwkasttdavllnklhhaadlekkqnetenrkllgtviqygnviqllhlksnkyl
    tvnkrlpalleknamrvtldeagnegswfyiqpfyklrsigdsvvigdkvvlnpvnagqp
    lhasshqlvdnpgcnevnsvncntswkivlflehhh