PDB entry 1xzy

View 1xzy on RCSB PDB site
Description: Solution structure of the P30-trans form of Alpha Hemoglobin Stabilizing Protein (AHSP)
Class: chaperone
Keywords: helical bundle, three-helix bundle
Deposited on 2004-11-12, released 2004-12-21
The last revision prior to the SCOP 1.75 freeze date was dated 2004-12-21, with a file datestamp of 2007-06-04.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: alpha-hemoglobin stabilizing protein
  Species: HOMO SAPIENS
  Gene: AHSP
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9NZD4 (0-89)
  Domains in SCOP 1.75: d1xzya_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1xzyA (A:)
  mallkankdlisaglkefsvllnqqvfndplvseedmvtvvedwmnfyinyyrqqvtgep
  qerdkalqelrqelntlanpflakyrdflk