PDB entry 1xzy

View 1xzy on RCSB PDB site
Description: Solution structure of the P30-trans form of Alpha Hemoglobin Stabilizing Protein (AHSP)
Class: chaperone
Keywords: helical bundle, three-helix bundle, CHAPERONE
Deposited on 2004-11-12, released 2004-12-21
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: alpha-hemoglobin stabilizing protein
    Species: Homo sapiens [TaxId:9606]
    Gene: AHSP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1xzya_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1xzyA (A:)
mallkankdlisaglkefsvllnqqvfndplvseedmvtvvedwmnfyinyyrqqvtgep
qerdkalqelrqelntlanpflakyrdflk