PDB entry 1xzo

View 1xzo on RCSB PDB site
Description: Identification of a disulfide switch in BsSco, a member of the Sco family of cytochrome c oxidase assembly proteins
Class: metal binding protein
Keywords: thioredoxin-like fold, Structural Genomics, Montreal-Kingston Bacterial Structural Genomics Initiative, BSGI, METAL BINDING PROTEIN
Deposited on 2004-11-12, released 2005-03-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: N/A
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hypothetical protein ypmQ
    Species: Bacillus subtilis [TaxId:1423]
    Gene: YPMQ
    Database cross-references and differences (RAF-indexed):
    • Uniprot P54178 (Start-173)
      • conflict (65)
    Domains in SCOPe 2.07: d1xzoa1
  • Chain 'B':
    Compound: Hypothetical protein ypmQ
    Species: Bacillus subtilis [TaxId:1423]
    Gene: YPMQ
    Database cross-references and differences (RAF-indexed):
    • Uniprot P54178 (Start-173)
      • conflict (65)
    Domains in SCOPe 2.07: d1xzob_
  • Heterogens: CD, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xzoA (A:)
    gsqqikdplnyevepftfqnqdgknvsleslkgevwladfiftnceticppmtahmtdlq
    kklkaenidvriisfsvdpendkpkqlkkfaanyplsfdnwdfltgysqseieefalksf
    kaivkkpegedqvihqssfylvgpdgkvlkdyngventpyddiisdvksastlk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xzoA (A:)
    qqikdplnyevepftfqnqdgknvsleslkgevwladfiftnceticppmtahmtdlqkk
    lkaenidvriisfsvdpendkpkqlkkfaanyplsfdnwdfltgysqseieefalksfka
    ivkkpegedqvihqssfylvgpdgkvlkdyngventpyddiisdvksastlk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1xzoB (B:)
    gsqqikdplnyevepftfqnqdgknvsleslkgevwladfiftnceticppmtahmtdlq
    kklkaenidvriisfsvdpendkpkqlkkfaanyplsfdnwdfltgysqseieefalksf
    kaivkkpegedqvihqssfylvgpdgkvlkdyngventpyddiisdvksastlk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xzoB (B:)
    qqikdplnyevepftfqnqdgknvsleslkgevwladfiftnceticppmtahmtdlqkk
    lkaenidvriisfsvdpendkpkqlkkfaanyplsfdnwdfltgysqseieefalksfka
    ivkkpegdqvihqssfylvgpdgkvlkdyngventpyddiisdvksastlk