PDB entry 1xzn

View 1xzn on RCSB PDB site
Description: PYRR, THE REGULATOR OF THE PYRIMIDINE BIOSYNTHETIC OPERON IN BACILLUS CALDOLYTICUS, sulfate-bound form
Class: transcription, transferase
Keywords: transcription regulation, attenuation protein, RNA-binding, pyrimidine biosynthesis, transferase, prtase, uracil phosphoribosyltransferase, bifunctional enzyme, transcription
Deposited on 2004-11-12, released 2005-03-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.27 Å
R-factor: 0.22
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: PyrR bifunctional protein
    Species: Bacillus caldolyticus [TaxId:1394]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1xzna_
  • Chain 'B':
    Compound: PyrR bifunctional protein
    Species: Bacillus caldolyticus [TaxId:1394]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1xznb_
  • Heterogens: MG, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xznA (A:)
    mqkavvmdeqairraltriaheiiernkgidgcvlvgiktrgiylarrlaerieqiegas
    vpvgelditlyrddltvktddheplvkgtnvpfpvternvilvddvlftgrtvraamdav
    mdlgrpariqlavlvdrghrelpiradfvgknvptsrselivvelsevdgidqvsihek
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xznA (A:)
    mqkavvmdeqairraltriaheiiernkgidgcvlvgiktrgiylarrlaerieqiegas
    vpvgelditlyrvpfpvternvilvddvlftgrtvraamdavmdlgrpariqlavlvdrg
    hrelpiradfvgknvptsrselivvelsevdgidqvsihek
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1xznB (B:)
    mqkavvmdeqairraltriaheiiernkgidgcvlvgiktrgiylarrlaerieqiegas
    vpvgelditlyrddltvktddheplvkgtnvpfpvternvilvddvlftgrtvraamdav
    mdlgrpariqlavlvdrghrelpiradfvgknvptsrselivvelsevdgidqvsihek
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xznB (B:)
    mqkavvmdeqairraltriaheiiernkgidgcvlvgiktrgiylarrlaerieqiegas
    vpvgelditlyvpfpvternvilvddvlftgrtvraamdavmdlgrpariqlavlvdrgh
    relpiradfvgknvptsrselivvelsevdgidqvsihek