PDB entry 1xzh

View 1xzh on RCSB PDB site
Description: fusarium solani cutinase mutant with thr 80 replaced by pro
Class: hydrolase (serine esterase)
Keywords: hydrolase, serine esterase, glycoprotein, hydrolase (serine esterase)
Deposited on 1995-11-28, released 1996-10-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.69 Å
R-factor: 0.146
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cutinase
    Species: Nectria haematococca mpVI [TaxId:70791]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00590
      • cloning artifact (31)
      • engineered (79)
    Domains in SCOPe 2.07: d1xzha_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xzhA (A:)
    lptsnpaqelearqlerttrddlingnsascadvifiyargstetgnlgtlgpsiasnle
    safgkdgvwiqgvggayraplgdnalprgtssaairemlglfqqantkcpdatliaggys
    qgaalaaasiedldsairdkiagtvlfgytknlqnrgripnypadrtkvfcntgdlvctg
    slivaaphlaygpdargpapefliekvravrgsa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xzhA (A:)
    rttrddlingnsascadvifiyargstetgnlgtlgpsiasnlesafgkdgvwiqgvgga
    yraplgdnalprgtssaairemlglfqqantkcpdatliaggysqgaalaaasiedldsa
    irdkiagtvlfgytknlqnrgripnypadrtkvfcntgdlvctgslivaaphlaygpdar
    gpapefliekvravrgs