PDB entry 1xz9

View 1xz9 on RCSB PDB site
Description: Structure of AF-6 PDZ domain
Class: Cell adhesion
Keywords: nmr, pdz, af-6
Deposited on 2004-11-12, released 2005-11-15
The last revision prior to the SCOP 1.73 freeze date was dated 2005-11-15, with a file datestamp of 2007-06-04.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Afadin
  Species: HOMO SAPIENS
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q5TIG6 (5-100)
    • cloning artifact (0-4)
    • see remark 999 (52)
  Domains in SCOP 1.73: d1xz9a1

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1xz9A (A:)
  gplgslrkepeiitvtlkkqngmglsivaakgagqdklgiyvksvvkggaadvdgrlaag
  dqllsvdgrslvglsqeraaelmtrtssvvtlevakqgaiy