PDB entry 1xz9

View 1xz9 on RCSB PDB site
Description: Structure of AF-6 PDZ domain
Class: Cell adhesion
Keywords: NMR, PDZ, AF-6, Cell adhesion
Deposited on 2004-11-12, released 2005-11-15
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-04-28, with a file datestamp of 2009-04-24.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Afadin
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5TIG6 (5-100)
      • cloning artifact (0-4)
      • see remark 999 (52)
    Domains in SCOPe 2.08: d1xz9a1, d1xz9a2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1xz9A (A:)
gplgslrkepeiitvtlkkqngmglsivaakgagqdklgiyvksvvkggaadvdgrlaag
dqllsvdgrslvglsqeraaelmtrtssvvtlevakqgaiy