PDB entry 1xz8

View 1xz8 on RCSB PDB site
Description: Pyrr, The Regulator Of The Pyrimidine Biosynthetic Operon In Bacillus caldolyticus, Nucleotide-bound form
Class: transcription, transferase
Keywords: transcription regulation, attenuation protein, RNA-binding, pyrimidine biosynthesis, transferase, prtase, uracil phosphoribosyltransferase, transcription
Deposited on 2004-11-11, released 2005-03-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.22
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: PyrR bifunctional protein
    Species: Bacillus caldolyticus [TaxId:1394]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1xz8a_
  • Chain 'B':
    Compound: PyrR bifunctional protein
    Species: Bacillus caldolyticus [TaxId:1394]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1xz8b_
  • Heterogens: MG, 5GP, 3GP, U5P, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xz8A (A:)
    mqkavvmdeqairraltriaheiiernkgidgcvlvgiktrgiylarrlaerieqiegas
    vpvgelditlyrddltvktddheplvkgtnvpfpvternvilvddvlftgrtvraamdav
    mdlgrpariqlavlvdrghrelpiradfvgknvptsrselivvelsevdgidqvsihek
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xz8A (A:)
    mqkavvmdeqairraltriaheiiernkgidgcvlvgiktrgiylarrlaerieqiegas
    vpvgelditlyrdvpfpvternvilvddvlftgrtvraamdavmdlgrpariqlavlvdr
    ghrelpiradfvgknvptsrselivvelsevdgidqvsihek
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1xz8B (B:)
    mqkavvmdeqairraltriaheiiernkgidgcvlvgiktrgiylarrlaerieqiegas
    vpvgelditlyrddltvktddheplvkgtnvpfpvternvilvddvlftgrtvraamdav
    mdlgrpariqlavlvdrghrelpiradfvgknvptsrselivvelsevdgidqvsihek
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xz8B (B:)
    mqkavvmdeqairraltriaheiiernkgidgcvlvgiktrgiylarrlaerieqiegas
    vpvgelditlyrvpfpvternvilvddvlftgrtvraamdavmdlgrpariqlavlvdrg
    hrelpiradfvgknvptsrselivvelsevdgidqvsihek