PDB entry 1xz6

View 1xz6 on RCSB PDB site
Description: Mutant ABO(H) blood group glycosyltransferase A
Class: transferase
Keywords: Rossman nucleotide binding fold, TRANSFERASE
Deposited on 2004-11-11, released 2004-12-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 1.55 Å
R-factor: N/A
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Histo-blood group ABO system transferase
    Species: Homo sapiens [TaxId:9606]
    Gene: ABO
    Database cross-references and differences (RAF-indexed):
    • Uniprot P16442 (1-End)
      • initiating methionine (0)
      • engineered (205)
    Domains in SCOPe 2.07: d1xz6a_
  • Heterogens: HG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xz6A (A:)
    mvslprmvypqpkvltpcrkdvlvvtpwlapivwegtfnidilneqfrlqnttigltvfa
    ikkyvaflklfletaekhfmvghrvhyyvftdqpaavprvtlgtgrqlsvlevraykrwq
    dvsmrrmemisdfcerrflsevdylvcvdvdmefrdhvgveiltplfgtlhpgfygssre
    aftyerrpqsqayipkdegdfyylgrffggsvqevqrltrachqammvdqangieavwhd
    eshlnkyllrhkptkvlspeylwdqqllgwpavlrklrftavpknhqavrnp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xz6A (A:)
    mvslprmvypqpkvltpcrkdvlvvtpwlapivwegtfnidilneqfrlqnttigltvfa
    ikkyvaflklfletaekhfmvghrvhyyvftdqpaavprvtlgtgrqlsvlevcerrfls
    evdylvcvdvdmefrdhvgveiltplfgtlhpgfygssreaftyerrpqsqayipkdegd
    fyylgrffggsvqevqrltrachqammvdqangieavwhdeshlnkyllrhkptkvlspe
    ylwdqqllgwpavlrklrftavp